YARS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86890

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all YARS Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for YARS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: YARS Antibody [NBP1-86890]

Immunocytochemistry/ Immunofluorescence: YARS Antibody [NBP1-86890]

Immunocytochemistry/Immunofluorescence: YARS Antibody [NBP1-86890] - Staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-86890 antibody. Corresponding YARS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Staining of human cerebral cortex, pancreas, skeletal muscle and testis using Anti-YARS antibody NBP1-86890 (A) shows similar protein distribution across tissues to independent antibody NBP1-86891 (B).
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody [NBP1-86890] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
YARS Antibody - BSA Free Immunohistochemistry-Paraffin: YARS Antibody - BSA Free [NBP1-86890]

Immunohistochemistry-Paraffin: YARS Antibody - BSA Free [NBP1-86890]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
YARS Antibody - BSA Free Western Blot: YARS Antibody - BSA Free [NBP1-86890]

Western Blot: YARS Antibody - BSA Free [NBP1-86890]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
YARS Antibody - BSA Free Western Blot: YARS Antibody - BSA Free [NBP1-86890]

Western Blot: YARS Antibody - BSA Free [NBP1-86890]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Applications for YARS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: YARS

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Alternate Names

CMTDIC, EC 6.1.1, EC 6.1.1.1, Tyrosyl--tRNA ligase, tyrosyl-tRNA synthetase, tyrosyl-tRNA synthetase, cytoplasmic, TYRRS, YRStyrRS, YTStyrosine tRNA ligase 1, cytoplasmic

Gene Symbol

YARS1

Additional YARS Products

Product Documents for YARS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for YARS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YARS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review YARS Antibody - BSA Free and earn rewards!

Have you used YARS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies