ZEB1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88845
![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0014.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chemotaxis, Chip Cytometry, Gel Supershift Assay, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Marker
Mesenchymal Cells Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
124 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ZEB1 Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88845-img0010.jpg "Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845]")
Immunocytochemistry/ Immunofluorescence: ZEB1 Antibody [NBP1-88845]
Immunocytochemistry/Immunofluorescence: ZEB1 Antibody [NBP1-88845] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0020.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human prostate shows strong nuclear positivity in smooth muscle cells.![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0008.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in stromal cells.![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0011.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0015.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.![Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]](https://resources.rndsystems.com/images/products/ZEB1-Antibody-Immunohistochemistry-Paraffin-NBP1-88845-img0017.jpg "Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]")
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845]
Immunohistochemistry-Paraffin: ZEB1 Antibody [NBP1-88845] - Staining of human glioma shows strong nuclear positivity in tumor cells.![ZEB1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZEB1 Antibody - BSA Free [NBP1-88845]](https://resources.rndsystems.com/images/products/nbp1-88845_rabbit-polyclonal-zeb1-antibody-25620259114050.jpg "Chromatin Immunoprecipitation-exo-Seq: ZEB1 Antibody - BSA Free [NBP1-88845]")
Chromatin Immunoprecipitation-exo-Seq: ZEB1 Antibody - BSA Free [NBP1-88845]
ChIP-Exo-Seq composite graph for Anti-ZEB1 (NBP1-88845) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Applications for ZEB1 Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
0.2 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ZEB1
Long Name
Zinc Finger E-box Binding Homeobox 1
Alternate Names
AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP
Entrez Gene IDs
6935 (Human)
Gene Symbol
ZEB1
UniProt
Additional ZEB1 Products
Product Documents for ZEB1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ZEB1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for ZEB1 Antibody - BSA Free
Powered by Bioz
Customer Reviews for ZEB1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ZEB1 Antibody - BSA Free and earn rewards!
Have you used ZEB1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for ZEB1 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: In looking at the Zeb1 antibodies on your website, the molecular weights of Zeb1 detected by several antibodies are different. Why is this?
A: ZEB1 is a rather large protein and undergoes a lot of post translational modifications such as phosphorylation and glycosylation (please see: UniProt P37275). The reason band patterns are different in the images may be due to sample type and how highly modified the ZEB1 protein is that the antibody is detecting. The more post translational modifications the higher you will detect the protein.
Loading...