ZEB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82991

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (94%), Rat (95%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Chromatin Immunoprecipitation-exo-Seq

Cited:

Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, IF/IHC, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZEB2/SIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZEB2 Antibody - BSA Free

Western Blot: ZEB2 Antibody [NBP1-82991]

Western Blot: ZEB2 Antibody [NBP1-82991]

Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Western Blot: ZEB2 Antibody [NBP1-82991]

Western Blot: ZEB2 Antibody [NBP1-82991]

ZEB2-Antibody-Western-Blot-NBP1-82991-img0018.jpg
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991]

Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.
ZEB2 Antibody

Western Blot: ZEB2 Antibody [NBP1-82991] -

SU5402, FGFR1 inhibitor, affects the EMT transcription factors.(A, B) ERK1/2 phosphorylation (p-ERK1/2) was determined by immunoblotting in HSC-4 & OTC-04 treated for 30 min with 30 ng/ml FGF2 or 30 ng/ml FGF7 in presence of 10% FBS (A) & in TSU & HOC313 cells treated for 1 h with 30 ng/ml FGF2 or 30 μM SU5402 in absence of FBS (B). F2, FGF2; F7, FGF7; SU, SU5402. (C) We have previously reported that, after treatment with TGF-beta, NMuMG cells underwent EMT with the IIIc-isoform of FGFR1[17]. After NMuMG cells pretreated with TGF-beta were transfected with mouse Fgfr1 siRNA or treated with SU5402, the cells were further incubated in culture medium (CM) from TSU cells. SU, SU5402; siFR1, siRNA against mouse Fgfr1. (D)FGF2 mRNA levels were determined by RT-qPCR analyses. The ratio of FGF2 mRNA to GAPDH mRNA in HSC-4 cells was indicated as “1”. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained in at least three independent experiments. (E) ERK1/2 phosphorylation (p-ERK1/2) in TSU & HOC313 cells were monitored in presence of indicated concentration of SU5402 for 1 h under serum-free culture conditions, followed by immunoblot analysis. (F, G) Expression of indicated genes in TSU cells under serum-free culture conditions was determined by RT-qPCR (F) & immunoblot (G) analyses, following treatment with 10 μM SU5402. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained from at least three independent experiments. p values were determined by Student’s t-test. **p < 0.01. (H) TSU cells treated with 10 μM U0126 in absence of FBS were subjected to immunoblotting with the indicated antibodies. alpha -tubulin was used as a loading control (A, B, C, E, G, & H). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31682640), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZEB2 Antibody

Western Blot: ZEB2 Antibody [NBP1-82991] -

Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is a downstream target of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in LN229 & U251 cells transfected with shTRIM14–1, shTRIM14–2 or control shRNA. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in LN229 & U251 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using LN229 & U251 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using LN229 & U251 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using LN229 & U251 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZEB2 Antibody

Western Blot: ZEB2 Antibody [NBP1-82991] -

Western Blot: ZEB2 Antibody [NBP1-82991] - TRIM14 function was demonstrated in vivo & IHC. a ShCtrl-transplanted & shTRIM14-transplanted LN229 cells were counted & transplanted in orthotopic nude mice model respectively, n = 6. b Survival curve of shCtrl-transplanted or shTRIM14-transplanted intracranial xenografts. ***, P < 0.001, n = 6. c Representative pseudocolour bioluminescence images of orthotopic tumours bearing control or TRIM14-depleted LN229 cells on the days as indicated. Quantification of tumor volume is shown. ***p < 0.001; n = 3 experiment. d The HE assay was performed to show tumor cytostructure. e Western blot analysis of TRIM14 & ZEB2 extracted from four pairs mice from shCtrl-transplanted group & shCtrl-transplanted group. Equal loading is confirmed by beta -actin levels. f IHC staining of TRIM14 & ZEB2 in four representative GBM specimens Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZEB2 Antibody

Western Blot: ZEB2 Antibody [NBP1-82991] -

Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is involved in the function of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in HS683 & U87 cells transfected with vector or TRIM14. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in HS683 & U87 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using HS683 & U87 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using HS683 & U87 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using HS683 & U87 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ZEB2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZEB2 Antibody - BSA Free [NBP1-82991]

Chromatin Immunoprecipitation-exo-Seq: ZEB2 Antibody - BSA Free [NBP1-82991]

ChIP-Exo-Seq composite graph for Anti-ZEB2 (NBP1-82991) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZEB2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 2 reviews rated 2.5 using NBP1-82991 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZEB2/SIP1

The ZEB2 gene (also known as SIP1 and SMADIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]

Alternate Names

HSPC082, SIP1, SMADIP1, ZFHX1B

Gene Symbol

ZEB2

Additional ZEB2/SIP1 Products

Product Documents for ZEB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZEB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Phosphatases and Regulators

Citations for ZEB2 Antibody - BSA Free

Customer Reviews for ZEB2 Antibody - BSA Free (2)

2.5 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
50%

Have you used ZEB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • ZEB2 Antibody
    Name: Xizi Wu
    Application: Immunohistochemistry-Frozen
    Sample Tested: Fixed frozen mouse spinal cord
    Species: Mouse
    Verified Customer | Posted 11/08/2019
    ZEB2 Antibody - BSA Free NBP1-82991
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • ZEB2 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Cancer Cell lines
    Species: Human
    Verified Customer | Posted 11/12/2017
    ZEB2 in various cancer cell lines
    Sample: Whole cell lysates of various cancer cell lines (10ug) Blocking: 5% nonfat dry milk reconstituted in TBS-T for 1 hour at room temperature Primary Antibody diluted (1:500) in 5% nonfat dry milk reconstituted in TBS-T overnight at 4deg C Secondary Antibody: Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/10000 dilution in TBS-T
    ZEB2 Antibody - BSA Free NBP1-82991

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies