ZIC4 Antibody (4B1) - Azide and BSA Free

Novus Biologicals | Catalog # H00084107-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4B1

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV

Reactivity Notes

Human. Other species not tested.

Specificity

ZIC4 - Zic family member 4

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for ZIC4 Antibody (4B1) - Azide and BSA Free

Western Blot: ZIC4 Antibody (4B1) [H00084107-M01]

Western Blot: ZIC4 Antibody (4B1) [H00084107-M01]

Western Blot: ZIC4 Antibody (4B1) [H00084107-M01] - ZIC4 monoclonal antibody (M01), clone 4B1 Analysis of ZIC4 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: ZIC4 Antibody (4B1) [H00084107-M01]

Immunocytochemistry/ Immunofluorescence: ZIC4 Antibody (4B1) [H00084107-M01]

Immunocytochemistry/Immunofluorescence: ZIC4 Antibody (4B1) [H00084107-M01] - Analysis of monoclonal antibody to ZIC4 on HeLa cell. Antibody concentration 25 ug/ml.
Sandwich ELISA: ZIC4 Antibody (4B1) [H00084107-M01] - Detection limit for recombinant GST tagged ZIC4 is approximately 0.03ng/ml as a capture antibody.

Applications for ZIC4 Antibody (4B1) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ZIC4

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function.

Alternate Names

FLJ42609, FLJ45833, Zic family member 4, Zinc finger protein of the cerebellum 4zinc family member 4 protein HZIC4, zinc finger protein ZIC 4

Entrez Gene IDs

84107 (Human)

Gene Symbol

ZIC4

OMIM

608948 (Human)

Additional ZIC4 Products

Product Documents for ZIC4 Antibody (4B1) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZIC4 Antibody (4B1) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZIC4 Antibody (4B1) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZIC4 Antibody (4B1) - Azide and BSA Free and earn rewards!

Have you used ZIC4 Antibody (4B1) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...