ZNF707 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92642

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF707 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF707 Antibody [NBP1-92642]

Immunocytochemistry/ Immunofluorescence: ZNF707 Antibody [NBP1-92642]

Immunocytochemistry/Immunofluorescence: ZNF707 Antibody [NBP1-92642] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
ZNF707 Antibody

Immunohistochemistry-Paraffin: ZNF707 Antibody [NBP1-92642] -

Immunohistochemistry-Paraffin: ZNF707 Antibody [NBP1-92642] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
ZNF707 Antibody

Immunohistochemistry-Paraffin: ZNF707 Antibody [NBP1-92642] -

Immunohistochemistry-Paraffin: ZNF707 Antibody [NBP1-92642] -Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
ZNF707 Antibody - BSA Free Western Blot: ZNF707 Antibody - BSA Free [NBP1-92642]

Western Blot: ZNF707 Antibody - BSA Free [NBP1-92642]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
ZNF707 Antibody - BSA Free Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
ZNF707 Antibody - BSA Free Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
ZNF707 Antibody - BSA Free Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Staining of human testis shows strong nuclear positivity in Leydig cells.
ZNF707 Antibody - BSA Free Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Immunohistochemistry: ZNF707 Antibody - BSA Free [NBP1-92642]

Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
ZNF707 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ZNF707 Antibody - BSA Free [NBP1-92642]

Chromatin Immunoprecipitation-exo-Seq: ZNF707 Antibody - BSA Free [NBP1-92642]

ChIP-Exo-Seq composite graph for Anti-ZNF707 (NBP1-92642) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ZNF707 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF707

ZNF707 may be involved in transcriptional regulation

Alternate Names

zinc finger protein 707

Gene Symbol

ZNF707

Additional ZNF707 Products

Product Documents for ZNF707 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF707 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF707 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF707 Antibody - BSA Free and earn rewards!

Have you used ZNF707 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...