Q: I am looking for some c-fos antibodies that could work in IHC.

A: Here are a list of products which might be of interest to you: Product List. We have additional filters on the left which may help you narrow down based on host species, target species, clonality, etc. We will guarantee these to work for all stated species and applications listed on the datasheet.

c-Fos Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89065

Submit a review

Citations (5)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all c-Fos Primary Antibodies »

Product Specifications

Immunogen

This c-Fos Antibody was developed against recombinant Protein corresponding to amino acids: DLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit c-Fos Antibody - BSA Free (NBP1-89065) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-c-Fos Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for c-Fos Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: c-Fos Antibody [NBP1-89065]

Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NBP1-89065] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065]

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065]

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065]

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human kidney shows weak to moderate nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065]

Immunohistochemistry-Paraffin: c-Fos Antibody [NBP1-89065] - Staining of human pancreas shows very weak and few nuclear positivity in exocrine glandular cells.

Chromatin Immunoprecipitation-exo-Seq: c-Fos Antibody - BSA Free [NBP1-89065]

ChIP-Exo-Seq composite graph for Anti-FOS (NBP1-89065) tested in MCF7 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

View 3 more images

Applications for c-Fos Antibody - BSA Free

Application

Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

Reported in scientific literature (PMID: 25726846)

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Fos

c-Fos is an intermediate early gene that is one of four members of the FOS family of activator protein-1 (AP-1) transcription factors, which also includes Fra-1, Fra-2, and FosB (1-3). Under the FOS gene, human c-Fos is synthesized as a protein of 308 amino acids (aa) with a basic leucine zipper (bZip) domain important for dimerization, and a basic domain for interacting with DNA, with a theoretical molecular weight of ~40.6 kDa (4,5). c-Fos can heterodimerize with members of the JUN family (c-Jun, JunB, and JunD) to form the active transcription factor AP-1 complex (3,5). AP-1 related proteins bind TPA-related responsive elements (TRE), cAMP responsive elements (CRE), and related sequences, with c-Fos:c-Jun dimers partial to TRE sites (5).

In response to stimuli, c-Fos, which is encoded by protooncogenes, has a role in cell proliferation, differentiation, and transformation (3,6). A variety of stimuli can increase c-Fos expression such as growth factors, proinflammatory cytokines, UV radiation, neurotransmitters, hormones, injury, and stress (1,6). c-Fos has long been used as a marker for neuronal activity and is associated with neural and behavioral responses following stimuli (1-3, 6-7). Mouse studies have revealed that c-Fos is important for efficient neurogenesis and cortical development (3). Additionally, c-Fos signal can be used as a molecular marker for learning and memory, such as recognition and fear (2,7). Studies have found that repeated positive stimuli result in increased Fos expression while, conversely, repeated negative value stimuli are indicated by decreased signal (7). Intermediate early genes have also been implicated in neuropsychiatric disorders including showing altered c-Fos expression in a schizophrenia animal model (2). Furthermore, antipsychotics and antidepressants are both capable of impacting c-Fos expression (2).

References

1. Kovacs K. J. (1998). c-Fos as a transcription factor: a stressful (re)view from a functional map. Neurochemistry International. https://doi.org/10.1016/s0197-0186(98)00023-0

2. Gallo, F. T., Katche, C., Morici, J. F., Medina, J. H., & Weisstaub, N. V. (2018). Immediate Early Genes, Memory and Psychiatric Disorders: Focus on c-Fos, Egr1 and Arc. Frontiers in Behavioral Neuroscience. https://doi.org/10.3389/fnbeh.2018.00079

3. Velazquez, F. N., Caputto, B. L., & Boussin, F. D. (2015). c-Fos importance for brain development. Aging. https://doi.org/10.18632/aging.100862

4. Uniprot (P01100)

5. Wu, Z., Nicoll, M., & Ingham, R. J. (2021). AP-1 family transcription factors: a diverse family of proteins that regulate varied cellular activities in classical hodgkin lymphoma and ALK+ ALCL. Experimental Hematology & Oncology. https://doi.org/10.1186/s40164-020-00197-9

6. Shaulian, E., & Karin, M. (2001). AP-1 in cell proliferation and survival. Oncogene. https://doi.org/10.1038/sj.onc.1204383

7. Chung L. (2015). A Brief Introduction to the Transduction of Neural Activity into Fos Signal. Development & Reproduction. https://doi.org/10.12717/DR.2015.19.2.061

Long Name

FBJ/Finkel–Biskis–Jinkins Murine Osteosarcoma Viral Oncogene Homolog

Alternate Names

cFos, FOS, G0S7

Gene Symbol

FOS

Additional c-Fos Products

Product Documents for c-Fos Antibody - BSA Free

Download Product Datasheets

Download SDS

Product Specific Notices for c-Fos Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Apoptosis Transcription Factors and Regulators

Basic Leucine Zipper (bZIP) Transcription Factors

C-type Lectin Receptors

IL-1 Family

NOD-like Receptors and the Inflammasome

PDGF Family

Toll-Like Receptors

Transcription Factors in the Akt Pathway

Citations for c-Fos Antibody - BSA Free

Customer Reviews for c-Fos Antibody - BSA Free

There are currently no reviews for this product. Be the first to review c-Fos Antibody - BSA Free and earn rewards!

Have you used c-Fos Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for c-Fos Antibody - BSA Free

Showing 1 - 1 的 1 FAQ Showing All

A: Here are a list of products which might be of interest to you: Product List. We have additional filters on the left which may help you narrow down based on host species, target species, clonality, etc. We will guarantee these to work for all stated species and applications listed on the datasheet.