Endoglin/CD105 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91212

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23147994)

Marker

Neo-endothelial Cells Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Endoglin/CD105 Antibody - BSA Free

Western Blot: Endoglin/CD105 Antibody [NBP1-91212]

Western Blot: Endoglin/CD105 Antibody [NBP1-91212]

Western Blot: Endoglin/CD105 Antibody [NBP1-91212] - Analysis in human cell line U-138 MG.
Endoglin/CD105 Antibody - BSA Free Western Blot: Endoglin/CD105 Antibody - BSA Free [NBP1-91212]

Western Blot: Endoglin/CD105 Antibody - BSA Free [NBP1-91212]

Analysis in human cell line U-138 MG.
Endoglin/CD105 Antibody - BSA Free Immunohistochemistry: Endoglin/CD105 Antibody - BSA Free [NBP1-91212]

Immunohistochemistry: Endoglin/CD105 Antibody - BSA Free [NBP1-91212]

Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Applications for Endoglin/CD105 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Endoglin/CD105

CD105 is a 90 kD homodimeric type I integral membrane glycoprotein, also known as endoglin. It is expressed on endothelial cells (especially on angiogenic endothelial cells) and up-regulated by hypoxia, activated monocytes, macrophages, bone marrow stromal cells, and some cytotrophoblasts. CD105 is a receptor for TGF- szlig1, TGF- szlig3 and modulates TGF- szlig signaling by interacting with TGF- szlig receptors I and/or II. CD105 also binds other growth factors such as actvin A, BMP-2 and -7. CD105 has been show to be a useful marker for identifying proliferating endothelium involved in tumor angiogenesis and can be used for tumor imaging, prognosis, as well as has therapeutic potential for some solid tumors and other angiogenic diseases.

Alternate Names

CD105, ENG

Gene Symbol

ENG

Additional Endoglin/CD105 Products

Product Documents for Endoglin/CD105 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Endoglin/CD105 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Endoglin/CD105 Antibody - BSA Free

Customer Reviews for Endoglin/CD105 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Endoglin/CD105 Antibody - BSA Free and earn rewards!

Have you used Endoglin/CD105 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Endoglin/CD105 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?

    A: We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.

  • Q: We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.

    A:

    We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

  • Q: I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?

    A: We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.

  • Q: We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.

    A:

    We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies