FGF basic/FGF2/bFGF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57096

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to FGF2(fibroblast growth factor 2 (basic)) The peptide sequence was selected from the middle region of FGF2. Peptide sequence RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FGF basic/FGF2/bFGF Antibody - BSA Free

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Antibody Titration: 2 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate.
Immunohistochemistry: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Immunohistochemistry: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Immunohistochemistry: FGF basic/FGF2 Antibody [NBP1-57096] - Human A375 cells Primary Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-Alexa-546 Secondary Antibody Dilution: 1 : 100Color/Signal Descriptions: Red: FGF2 Blue: Nuclei.
Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2/bFGF Antibody [NBP1-57096]

Western Blot: FGF basic/FGF2 Antibody [NBP1-57096] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for FGF basic/FGF2/bFGF Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FGF basic/FGF2/bFGF

The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Fibroblast Growth Factor basic

Alternate Names

bFGF, FGF-2, FGF2, HBGF-2, Prostatropin

Gene Symbol

FGF2

Additional FGF basic/FGF2/bFGF Products

Product Documents for FGF basic/FGF2/bFGF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF basic/FGF2/bFGF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FGF basic/FGF2/bFGF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FGF basic/FGF2/bFGF Antibody - BSA Free and earn rewards!

Have you used FGF basic/FGF2/bFGF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF basic/FGF2/bFGF Antibody - BSA Free

Showing  1 - 56 FAQs Showing All
  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

  • Q: Does human FGF basic show activity on mouse cells?

    A: Yes, it does. The bioassay uses NR-6 mouse fibroblast cells.  There is 95% homology between the human and mouse protein and 98% homology between the human and mouse receptor.

  • Q: Does the human beta -NGF polyclonal antibody (Catalog # AB-256-NA) cross-react with human BDNF, human NT-3, or mouse beta -NGF?

    A: In Western blot, less than 5% cross-reactivity was observed with recombinant mouse β-NGF and recombinant rat β-NGF, and no cross-reactivity was observed with recombinant human (rh) NT-3 and rhNT-4.

  • Q: I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

    A: Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits, but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

  • Q: What is the heparin binding activity of FGF and VEGF?

    A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.

  • Q: What is the specificity and cross-reactivity of Catalog # AB-233-NA?

    A: For Western blot, less than 5% cross-reactivity was observed with recombinant human (rh) β-ECGF, and no cross-reactivity was observed with rhFGF acidic, FGF-4, FGF-5, FGF-6, FGF-7, and FGF-9.

  • Q: What receptors does FGF basic bind?

    A: FGF receptor specificity has been reviewed in multiple citations. Please find more information at: //www.rndsystems.com/resources/articles/fibroblast-growth-factors-and-their-receptors

Showing  1 - 56 FAQs Showing All
View all FAQs for Antibodies