ICAM-1/CD54 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88700
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRD
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ICAM-1/CD54 Antibody - BSA Free
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700]
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human kidney, lung, lymph node and skeletal muscle using Anti-ICAM1 antibody NBP1-88700 (A) shows similar protein distribution across tissues to independent antibody NBP1-88701 (B).Western Blot: ICAM-1/CD54 Antibody [NBP1-88700]
Western Blot: ICAM-1/CD54 Antibody [NBP1-88700] - Analysis in human lung tissue.Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700]
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700]
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human lymph node shows moderate membranous positivity.Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700]
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human lung shows moderate membranous positivity in pneumocytes.Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700]
Immunohistochemistry-Paraffin: ICAM-1/CD54 Antibody [NBP1-88700] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Western Blot: ICAM-1/CD54 Antibody - BSA Free [NBP1-88700] -
ADAR1 knockdown results in dsRNA increases, type I interferon signaling and pro-inflammatory protein expression. (A) Immunoblots for MDA5 and RIG-I following ADAR1 knockdown. Unpaired t-test; n = 6/condition. (B) Representative images and relative J2 (dsRNA antibody) immunofluorescence signal showing dsRNA accumulation following ADAR1 knockdown. (C) Representative immunofluorescence images showing co-localization of dsRNA (J2) and MDA5 after transfection with ADAR1 siRNA. (D) Summary immunoblot data for ICAM-1, TNF-alpha, pIRF3, pNF-kappa B, and (E) representative images following ADAR1 knockdown. (F) Concentrations of CXCL10 and IFN beta following ADAR1 siRNA knockdown. **p ≤ 0.01, ***p ≤ 0.001, ****p ≤ 0.0001 in unpaired t-test; n = 9/condition. Error bars represent SD. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38035265), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ICAM-1/CD54 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ICAM-1/CD54
Long Name
Intercellular Adhesion Molecule 1
Alternate Names
CD54, ICAM1
Gene Symbol
ICAM1
Additional ICAM-1/CD54 Products
Product Documents for ICAM-1/CD54 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ICAM-1/CD54 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ICAM-1/CD54 Antibody - BSA Free
Customer Reviews for ICAM-1/CD54 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ICAM-1/CD54 Antibody - BSA Free and earn rewards!
Have you used ICAM-1/CD54 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars