MMP-9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39011

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MMP-9 Antibody - BSA Free

Western Blot: MMP-9 Antibody [NBP2-39011]

Western Blot: MMP-9 Antibody [NBP2-39011]

Western Blot: MMP-9 Antibody [NBP2-39011] - Analysis in control (vector only transfected HEK293T lysate) and MMP9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011] - Staining in human bone marrow and cerebral cortex tissues using NBP2-39011 antibody. Corresponding MMP9 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011]

Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP2-39011] - Staining of human prostate shows no positivity in glandular cells as expected.

Applications for MMP-9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP-9

Matrix metalloproteinases (MMPs) are zinc-dependent endopeptidases that degrade substances within the extracellular matrix. The MMP family includes six different groups of enzymes: collagenases, gelatinases, stromelysins, transmembrane MMPs, matrilysins and others. MMPs are secreted as proenzymes that have to be cleaved in order to be activated. Other MMPs, plasmins as well as other factors activate MMPs. MMPs are thought to play an important role in tissue remodeling associated with various physiological and pathological processes. MMP9 degrades of proteins in the extracellular matrix and activates growth factors like proTGF beta and proTNF alpha. MMP9 contributes to the invasion and metastasis of various human malignancies.

Long Name

Matrix Metalloproteinase 9

Alternate Names

CLG4B, Gelatinase B, GELB, MANDP2, MMP9

Gene Symbol

MMP9

UniProt

Additional MMP-9 Products

Product Documents for MMP-9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP-9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MMP-9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP-9 Antibody - BSA Free and earn rewards!

Have you used MMP-9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MMP-9 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q:  I’m looking for a pair of antibodies to MMP-9 that can be used in a sandwich assay. Do you carry any? 

    A:

    We have 10 primary antibodies for MMP-9 that have been tested in ELISA, seen here.
    It looks like 2 have been tested for capture (please note the tested species for each of these), seen here.
    6 have been tested for detection, seen here.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies