SHC1 Antibody (3F4) - Azide and BSA Free
Novus Biologicals | Catalog # H00006464-M01
![Western Blot: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Western-Blot-H00006464-M01-img0015.jpg "Western Blot: SHC1 Antibody (3F4) [H00006464-M01]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay
Cited:
Proximity Ligation Assay
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 3F4
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SHC1 (AAH33925, 171 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLS
Specificity
SHC1 - SHC (Src homology 2 domain containing) transforming protein 1
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for SHC1 Antibody (3F4) - Azide and BSA Free
Western Blot: SHC1 Antibody (3F4) [H00006464-M01]
Western Blot: SHC1 Antibody (3F4) [H00006464-M01] - SHC1 monoclonal antibody (M01), clone 3F4 Analysis of SHC1 expression in A-431.![Immunocytochemistry/ Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Immunocytochemistry-Immunofluorescence-H00006464-M01-img0011.jpg "Immunocytochemistry/ Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01]")
Immunocytochemistry/ Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01]
Immunocytochemistry/Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on A-431 cell. Antibody concentration 10 ug/ml.![Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Immunohistochemistry-Paraffin-H00006464-M01-img0013.jpg "Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01]")
Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01]
Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1 ug/ml.![Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Proximity-Ligation-Assay-H00006464-M01-img0007.jpg "Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]")
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Protein-protein interactions between STAT5A and SHC1 Mahlavu cells were stained with anti-STAT5A rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).![Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Proximity-Ligation-Assay-H00006464-M01-img0008.jpg "Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]")
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).![Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-Proximity-Ligation-Assay-H00006464-M01-img0009.jpg "Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]")
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01]
Proximity Ligation Assay: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of protein-protein interactions between PIK3R1 and SHC1. Huh7 cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).![ELISA: SHC1 Antibody (3F4) [H00006464-M01]](https://resources.rndsystems.com/images/products/SHC1-Antibody-3F4-ELISA-H00006464-M01-img0016.jpg "ELISA: SHC1 Antibody (3F4) [H00006464-M01]")
ELISA: SHC1 Antibody (3F4) [H00006464-M01]
ELISA: SHC1 Antibody (3F4) [H00006464-M01] - Detection limit for recombinant GST tagged SHC1 is approximately 0.03ng/ml as a capture antibody.Applications for SHC1 Antibody (3F4) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Proximity Ligation Assay
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: SHC1
Long Name
SHC-transforming Protein 1
Alternate Names
SHCA
Entrez Gene IDs
6464 (Human)
Gene Symbol
SHC1
OMIM
600560 (Human)
UniProt
Additional SHC1 Products
Product Documents for SHC1 Antibody (3F4) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SHC1 Antibody (3F4) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for SHC1 Antibody (3F4) - Azide and BSA Free
Powered by Bioz
Customer Reviews for SHC1 Antibody (3F4) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SHC1 Antibody (3F4) - Azide and BSA Free and earn rewards!
Have you used SHC1 Antibody (3F4) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
IL-9 Signaling Pathways
IL-15 Signaling Pathways
IL-21 Signaling Pathways
MAPK Signaling: Oxidative Stress Pathway
TGF-beta Signaling Pathways
VEGF - VEGF R2 Signaling Pathways
