58K Golgi Protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48601

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEH

Reactivity Notes

Mouse (89%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 58K Golgi Protein Antibody - BSA Free

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining in human liver and pancreas tissues using anti-FTCD antibody. Corresponding FTCD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human cerebral cortex, colon, kidney and liver using Anti-FTCD antibody NBP2-48601 (A) shows similar protein distribution across tissues to independent antibody NBP2-48600 (B).
Western Blot: 58K Golgi Protein Antibody [NBP2-48601]

Western Blot: 58K Golgi Protein Antibody [NBP2-48601]

Western Blot: 58K Golgi Protein Antibody [NBP2-48601] - Analysis using Anti-FTCD antibody NBP2-48601 (A) shows similar pattern to independent antibody NBP2-48600 (B).
Immunocytochemistry/ Immunofluorescence: 58K Golgi Protein Antibody [NBP2-48601]

Immunocytochemistry/ Immunofluorescence: 58K Golgi Protein Antibody [NBP2-48601]

Immunocytochemistry/Immunofluorescence: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human colon.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human kidney.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601]

Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48601] - Staining of human liver using Anti-FTCD antibody NBP2-48601.

Applications for 58K Golgi Protein Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 58K Golgi Protein

58K protein antibodies are excellent for use as markers for the Golgi complex. The 58K protein has been identified as being FTCD, a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Defects in FTCD are the cause of glutamate formiminotransferase deficiency; also known as formiminoglutamicaciduria (FIGLU-uria). It is an autosomal recessive disorder. Features of a severe phenotype, include elevated levels of formiminoglutamate (FIGLU) in the urine in response to histidine administration, megaloblastic anemia, and mental retardation. Features of a mild phenotype include high urinary excretion of FIGLU in the absence of histidine administration, mild developmental delay, and no hematological abnormalities.

Alternate Names

formimidoyltransferase cyclodeaminase, formimidoyltransferase-cyclodeaminase, formiminotransferase cyclodeaminase, Formiminotransferase-cyclodeaminase, human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase, LCHC1

Gene Symbol

FTCD

Additional 58K Golgi Protein Products

Product Documents for 58K Golgi Protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 58K Golgi Protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 58K Golgi Protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 58K Golgi Protein Antibody - BSA Free and earn rewards!

Have you used 58K Golgi Protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...