ACAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89285

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ACAT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285] - Staining of human cerebellum, kidney, liver and testis using Anti-ACAT1 antibody NBP1-89285 (A) shows similar protein distribution across tissues to independent antibody NBP1-89284 (B).
Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ACAT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285] - Analysis using Anti-ACAT1 antibody NBP1-89285 (A) shows similar pattern to independent antibody NBP1-89284 (B).
Immunocytochemistry/ Immunofluorescence: ACAT1 Antibody [NBP1-89285]

Immunocytochemistry/ Immunofluorescence: ACAT1 Antibody [NBP1-89285]

Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89285] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285] - Staining of human testis shows strong positivity in mitochondria in cells in seminiferous ducts.
Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285] - Staining of human cerebellum shows strong positivity in mitochondria in purkinje cells.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285] - Staining of human liver shows strong positivity in mitochondria in hepatocytes.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285]

Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89285] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.
Knockout Validated: ACAT1 Antibody [NBP1-89285]

Western Blot: ACAT1 Antibody [NBP1-89285]

ACAT1-Antibody-Knockout-Validated-NBP1-89285-img0017.jpg
ACAT1 Antibody

Western Blot: ACAT1 Antibody [NBP1-89285] -

Western Blot: ACAT1 Antibody [NBP1-89285] - Blocking LD formation increases C. burnetii growth.Wild-type C. burnetii growth in infected MH-S cells treated with different inhibitors was measured at 2 & 4 days post-infection by FFU assay. A-D) Representative images for wild-type MH-S macrophages treated with inhibitors, fixed, stained for PLIN2 (LDs; green) & C. burnetii (red) & imaged day 4 post-treatment at 100X. Scale bar = 10 µm. E) Growth while inhibiting LD formation with triacsin C (10 µM) in wild-type MH-S macrophages. Error bars represent the mean of 4 independent experiments +/- SEM. ** = p <0.01 compared to vehicle-treated cells as determined by two-way ANOVA with Bonferroni post-hoc test. F) ACAT1 protein expression in wild-type & acat-1-/- macrophages. Cell lysates were immunoblotted & ACAT1 protein levels were compared with GAPDH as loading control. G) C. burnetii growth in vehicle-treated wild-type & acat-1-/- MH-S macrophages & (H) T863-treated acat-1-/- MH-S macrophages. Error bars represent the mean of at least 3 independent experiments +/- SEM., * = p<0.05, *** = p <0.001 as determined by two-way ANOVA with Bonferroni post-hoc test. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0192215), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ACAT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACAT1

Sterol O-acyltransferase 1 (SOAT1), also known as ACAT1, catalyzes the formation of intracellular cholesterol esters in various tissues, such as adult human liver, adrenal glands, macrophages, and kidneys. Specifically, ACAT-1 catalyzes the reversible reaction forming acetoacetyl-CoA from two molecules of acetyl-CoA. Additionaly, the ACAT 1 protein may have a role in lipoprotein assembly and dietary cholesterol absorption, and may also act as a ligase.

Mutations in this gene have been associated with 3-ketothiolase deficiency, an inborn defect of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Long Name

Acetyl-CoA Acetyltransferase 1

Alternate Names

THIL

Gene Symbol

ACAT1

Additional ACAT1 Products

Product Documents for ACAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ACAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bioactive Lipids and Receptors

Citations for ACAT1 Antibody - BSA Free

Customer Reviews for ACAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACAT1 Antibody - BSA Free and earn rewards!

Have you used ACAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies