ACE-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88123
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Reactivity Notes
Reactivity reported in scientific literature (PMID: 20398667)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ACE-2 Antibody - BSA Free
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human duodenum shows strong positivity in apical membranes in glandular cells.Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human tonsil shows no positivity in lymphoid cells as expected.Flow Cytometry: ACE-2 Antibody [NBP1-88123]
Flow Cytometry: ACE-2 Antibody [NBP1-88123] - Detection of ACE-2 in HEK293 Human Cell Line Transfected with Human ACE-2 and eGFP by Flow Cytometry. HEK293 human embryonic kidney cell line transfected with (A) human ACE-2 or (B) irrelevant protein, and eGFP was stained with Rabbit Anti-Human ACE-2 Polyclonal Antibody (Catalog # NBP1-88123) followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). Quadrant markers were set based on Rabbit IgG control antibody staining (Catalog # MAB1050, data not shown). View our protocol for Staining Membrane-associated Proteins.Western Blot: ACE-2 Antibody - BSA Free [NBP1-88123]
Analysis in human kidney tissue.Applications for ACE-2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ACE-2
Genetic data from Drosophila, mice and rats show that the ACE2 protein is an essential regulator of heart function in vivo. ACE2 mRNA is found at high levels in testis, kidney and heart with moderate levels in colon, small intestine, and ovary. The ACE2 protein contributes to organ function through the renin-angiotensin system, playing a central role in vascular, renal, and myocardial physiology.
Virology research has demonstrated that the severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein binds to its functional receptor, ACE2 (1). Vimentin is a type III intermediate filament protein expressed in mesenchymal cells that helps comprise the cytoskeleton in all animal cells. Studies have demonstrated that vimentin allows cell binding that allows the uptake of SARS-CoV spike protein into a host (2). This direct interaction of SARS-CoV with vimentin has been identified as an entry mechanism for the virus into a host, mediated by the SARS-CoV receptor ACE2 (1,2). It has been shown that ACE2 is the SARS-CoV-2 receptor required for cell entry and plays a physiological role in the replication of SARS-CoV in an infected host (1). Studies using human ACE2 antibody demonstrated a blockade of SARS-CoV-2 and ACE2 interaction, indicating an important physiological component of viral transmission and potential anti-viral therapeutic strategies (3).
References
1. Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A.,... Farzan, M. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 426(6965), 450-454. doi:10.1038/nature02145
2. Yu YT, Chien SC, Chen IY, Lai CT, Tsay YG, Chang SC, Chang MF. (2016) Surface vimentin is critical for the cell entry of SARS-CoV. J Biomed Sci. doi: 10.1186/s12929-016-0234-7
3. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S.,... Pohlmann, S. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. doi:10.1016/j.cell.2020.02.052
Long Name
Angiotensin I Converting Enzyme 2
Alternate Names
ACE2, ACEH
Gene Symbol
ACE2
Additional ACE-2 Products
Product Documents for ACE-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ACE-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ACE-2 Antibody - BSA Free
Customer Reviews for ACE-2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ACE-2 Antibody - BSA Free and earn rewards!
Have you used ACE-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...