ACE-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88123

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20398667)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ACE-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining in human small intestine and tonsil tissues.. Corresponding ACE2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human duodenum shows strong positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123]

Immunohistochemistry-Paraffin: ACE-2 Antibody [NBP1-88123] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Flow Cytometry: ACE-2 Antibody [NBP1-88123]

Flow Cytometry: ACE-2 Antibody [NBP1-88123]

Flow Cytometry: ACE-2 Antibody [NBP1-88123] - Detection of ACE-2 in HEK293 Human Cell Line Transfected with Human ACE-2 and eGFP by Flow Cytometry. HEK293 human embryonic kidney cell line transfected with (A) human ACE-2 or (B) irrelevant protein, and eGFP was stained with Rabbit Anti-Human ACE-2 Polyclonal Antibody (Catalog # NBP1-88123) followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). Quadrant markers were set based on Rabbit IgG control antibody staining (Catalog # MAB1050, data not shown). View our protocol for Staining Membrane-associated Proteins.
ACE-2 Antibody - BSA Free Western Blot: ACE-2 Antibody - BSA Free [NBP1-88123]

Western Blot: ACE-2 Antibody - BSA Free [NBP1-88123]

Analysis in human kidney tissue.

Applications for ACE-2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACE-2

Angiotensin I Converting Enzyme 2 (ACE2), also known as ACEH (ACE homologue), is an integral membrane protein and a zinc metalloprotease of the ACE family (theoretical molecular weight 92 kDa). The predicted mouse ACE2 protein sequence consists of 798 amino acids, including an N-terminal signal peptide, a single catalytic domain, a C-terminal membrane anchor, and a short cytoplasmic tail. Mouse ACE2 is 40% homologous in amino acid identity to the N- and C-terminal domains of mouse somatic ACE. Enzymatically, ACE2 converts the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts Ang I to Ang II.

Genetic data from Drosophila, mice and rats show that the ACE2 protein is an essential regulator of heart function in vivo. ACE2 mRNA is found at high levels in testis, kidney and heart with moderate levels in colon, small intestine, and ovary. The ACE2 protein contributes to organ function through the renin-angiotensin system, playing a central role in vascular, renal, and myocardial physiology.

Virology research has demonstrated that the severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein binds to its functional receptor, ACE2 (1). Vimentin is a type III intermediate filament protein expressed in mesenchymal cells that helps comprise the cytoskeleton in all animal cells. Studies have demonstrated that vimentin allows cell binding that allows the uptake of SARS-CoV spike protein into a host (2). This direct interaction of SARS-CoV with vimentin has been identified as an entry mechanism for the virus into a host, mediated by the SARS-CoV receptor ACE2 (1,2). It has been shown that ACE2 is the SARS-CoV-2 receptor required for cell entry and plays a physiological role in the replication of SARS-CoV in an infected host (1). Studies using human ACE2 antibody demonstrated a blockade of SARS-CoV-2 and ACE2 interaction, indicating an important physiological component of viral transmission and potential anti-viral therapeutic strategies (3).

References

1. Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A.,... Farzan, M. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 426(6965), 450-454. doi:10.1038/nature02145

2. Yu YT, Chien SC, Chen IY, Lai CT, Tsay YG, Chang SC, Chang MF. (2016) Surface vimentin is critical for the cell entry of SARS-CoV. J Biomed Sci. doi: 10.1186/s12929-016-0234-7

3. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S.,... Pohlmann, S. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. doi:10.1016/j.cell.2020.02.052

Long Name

Angiotensin I Converting Enzyme 2

Alternate Names

ACE2, ACEH

Gene Symbol

ACE2

Additional ACE-2 Products

Product Documents for ACE-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACE-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ACE-2 Antibody - BSA Free

Customer Reviews for ACE-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ACE-2 Antibody - BSA Free and earn rewards!

Have you used ACE-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies