Aconitase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87677

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aconitase 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aconitase 1 Antibody - BSA Free

Aconitase 1 Antibody

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Analysis in human kidney and skeletal muscle tissues using NBP1-87677 antibody. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677]

Aconitase-1-Antibody-Western-Blot-NBP1-87677-img0023.jpg
Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677]

Immunocytochemistry/ Immunofluorescence: Aconitase 1 Antibody [NBP1-87677]

Immunocytochemistry/Immunofluorescence: Aconitase 1 Antibody [NBP1-87677] - Staining of human cell line U-2 OS shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Aconitase 1 Antibody [NBP1-87677]

Western Blot: Aconitase 1 Antibody [NBP1-87677]

Aconitase-1-Antibody-Western-Blot-NBP1-87677-img0024.jpg
Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677]

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677]

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Aconitase 1 Antibody

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Staining of human skeletal muscle shows no positivity in myocytes as expected.
Aconitase 1 Antibody

Western Blot: Aconitase 1 Antibody [NBP1-87677] -

Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1.A) Total IRP1 activity was measured by RNA band shift assay. B) Densitometric analysis of IRP1 activity. C) Hepatic IRP1 protein levels evaluated by Western Blotting. C) Densitometric analysis of IRP1 protein levels; beta -actin is shown as the loading control. D). Effect of HFD on IRP1 & IRP2 mRNA levels. Gene expression was evaluated by qRT-PCR. The figure is representative of results obtained in 6 animals per group in two independent experiments. Values are expressed as means±SD. AU, arbitrary units. *p<0.05 vs controls. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Aconitase 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 2 reviews rated 2.5 using NBP1-87677 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aconitase 1

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Alternate Names

Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS

Gene Symbol

ACO1

Additional Aconitase 1 Products

Product Documents for Aconitase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aconitase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Aconitase 1 Antibody - BSA Free

Customer Reviews for Aconitase 1 Antibody - BSA Free (2)

2.5 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
50%

Have you used Aconitase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Aconitase 1 Antibody
    Name: Nicholas Niemuth
    Application: Western Blot
    Sample Tested: Purified protein and Whole organism protein extract
    Species: Bovine and Chironomus riprius
    Verified Customer | Posted 03/09/2020
    Visualization of nitrocellulose membrane from 10% SDS-PAGE gel for ladder, bovine heart aconitase, and whole organism protein extract from Chironomus riparius larvae. IR anti-rabbit secondary antibody. NBP1-87677 gives only non-specific bands.
    Aconitase 1 Antibody - BSA Free NBP1-87677
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: mouse lung
    Species: Mouse
    Verified Customer | Posted 07/28/2014

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies