Aconitase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90264

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aconitase 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Aconitase 2 Antibody [NBP1-90264]

Immunocytochemistry/ Immunofluorescence: Aconitase 2 Antibody [NBP1-90264]

Immunocytochemistry/Immunofluorescence: Aconitase 2 Antibody [NBP1-90264] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining in human heart muscle and liver tissues using NBP1-90264 antibody. Corresponding ACO2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human liver shows very weak positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human duodenum shows strong strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human kidney shows strong strong granular cytoplasmic positivity in cells in tubules.
Aconitase 2 Antibody - BSA Free Western Blot: Aconitase 2 Antibody - BSA Free [NBP1-90264]

Western Blot: Aconitase 2 Antibody - BSA Free [NBP1-90264]

Analysis in human cell line HL-60.
Aconitase 2 Antibody - BSA Free Western Blot: Aconitase 2 Antibody - BSA Free [NBP1-90264]

Western Blot: Aconitase 2 Antibody - BSA Free [NBP1-90264]

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry: Aconitase 2 Antibody [NBP1-90264]

Immunohistochemistry: Aconitase 2 Antibody [NBP1-90264]

Aconitase-2-Antibody-Immunohistochemistry-NBP1-90264-img0013.jpg
Aconitase 2 Antibody

Western Blot: Aconitase 2 Antibody [NBP1-90264] -

Western Blot: Aconitase 2 Antibody [NBP1-90264] - The regulation mechanism of LOX1 on alveolar epithelial cell apoptosis & fibrosis. (a) Cells were transfected with a LOX1 overexpression plasmid & control vector. ROS levels were determined by DCFH-DA assay in MLE-12 cells treated by TGF-beta 1, TGF-beta 1 plus exosome, TGF-beta 1 plus exosome & vector, & TGF-beta 1 plus exosome & LOX1 overexpression plasmid (n = 3). (b) Detection of cellular mtDNA/18sRNA in each of the above cell groups (n = 3). (c) The expression of LOX1, caspase 3, mtDNA damage markers SIRT3 & ACO2, & NLRP3 was measured by western blotting in each of the above cell groups. (d) The expression of the same signal cascades including LOX1, caspase 3, SIRT3, ACO2, & NLRP3 was confirmed in an animal model with pulmonary fibrosis by western blot assay. Data is shown as the means ± SD, n ≥ 3. ∗∗p < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31949877), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Aconitase 2 Antibody

Western Blot: Aconitase 2 Antibody [NBP1-90264] -

Western Blot: Aconitase 2 Antibody [NBP1-90264] - The regulation mechanism of LOX1 on alveolar epithelial cell apoptosis & fibrosis. (a) Cells were transfected with a LOX1 overexpression plasmid & control vector. ROS levels were determined by DCFH-DA assay in MLE-12 cells treated by TGF-beta 1, TGF-beta 1 plus exosome, TGF-beta 1 plus exosome & vector, & TGF-beta 1 plus exosome & LOX1 overexpression plasmid (n = 3). (b) Detection of cellular mtDNA/18sRNA in each of the above cell groups (n = 3). (c) The expression of LOX1, caspase 3, mtDNA damage markers SIRT3 & ACO2, & NLRP3 was measured by western blotting in each of the above cell groups. (d) The expression of the same signal cascades including LOX1, caspase 3, SIRT3, ACO2, & NLRP3 was confirmed in an animal model with pulmonary fibrosis by western blot assay. Data is shown as the means ± SD, n ≥ 3. ∗∗p < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31949877), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Aconitase 2 Antibody

Western Blot: Aconitase 2 Antibody [NBP1-90264] -

Western Blot: Aconitase 2 Antibody [NBP1-90264] - The regulation mechanism of LOX1 on alveolar epithelial cell apoptosis & fibrosis. (a) Cells were transfected with a LOX1 overexpression plasmid & control vector. ROS levels were determined by DCFH-DA assay in MLE-12 cells treated by TGF-beta 1, TGF-beta 1 plus exosome, TGF-beta 1 plus exosome & vector, & TGF-beta 1 plus exosome & LOX1 overexpression plasmid (n = 3). (b) Detection of cellular mtDNA/18sRNA in each of the above cell groups (n = 3). (c) The expression of LOX1, caspase 3, mtDNA damage markers SIRT3 & ACO2, & NLRP3 was measured by western blotting in each of the above cell groups. (d) The expression of the same signal cascades including LOX1, caspase 3, SIRT3, ACO2, & NLRP3 was confirmed in an animal model with pulmonary fibrosis by western blot assay. Data is shown as the means ± SD, n ≥ 3. ∗∗p < 0.01. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31949877), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Aconitase 2 Antibody - BSA Free

Immunohistochemistry: Aconitase 2 Antibody - BSA Free [NBP1-90264] -

STED super-resolution microscopy of mitochondria in the rectal Muscularis externa demonstrates high structural preservation of the stored paraffin-embedded tissue.STED recordings were performed on 2 um thick dewaxed sections cut along the longitudinal axis of the rectum. (A) Left: STED overview image of a region of the inner circular layer of the rectal Muscularis externa decorated with an antiserum against Tom20. Right: Magnifications of the areas in the indicated dashed squares showing the distribution of TOM clusters within the mitochondria. (B–E) STED images of tissue sections decorated with antisera against Tom20 (B), Mic60 (mitofilin) (C), aconitase (D), and cyclophilin D (E). In each panel the confocal (top, left) and the corresponding STED image (top, right) is displayed. Bottom: Magnification of the STED image as indicated by a dashed square. Note the different distributions of the four proteins within the mitochondria. Scale bars: 20 um (A, left); 1 um (A, right) and (B–E, top); 200 nm (B–E, bottom). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/25025184), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Aconitase 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aconitase 2

Aconitase 2 is encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq]

Alternate Names

Aconitase, aconitase 2, mitochondrial, aconitate hydratase, mitochondrial, ACONM, Citrate hydro-lyase, EC 4.2.1, EC 4.2.1.3, MGC20605, MGC33908

Entrez Gene IDs

50 (Human); 11429 (Mouse); 79250 (Rat)

Gene Symbol

ACO2

UniProt

Additional Aconitase 2 Products

Product Documents for Aconitase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aconitase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Aconitase 2 Antibody - BSA Free

Customer Reviews for Aconitase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aconitase 2 Antibody - BSA Free and earn rewards!

Have you used Aconitase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...