ACSL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89270

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ACSL1 Antibody - BSA Free

Western Blot: ACSL1 Antibody [NBP1-89270]

Western Blot: ACSL1 Antibody [NBP1-89270]

Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).
Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody [NBP1-89270]

Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody [NBP1-89270]

Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein distribution across tissues to independent antibody NBP1-89271 (B).
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Analysis in human liver and tonsil tissues. Corresponding ACSL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human soft tissues shows moderate to strong cytoplasmic positivity in adipocytes.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]

Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Applications for ACSL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 3 using NBP1-89270 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSL1

Long-chain-fatty-acid--CoA ligase 1, or ACSL1, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in lipid biosynthesis and fatty acid degradation. Like other isozymes of this family, ALCS1 converts free long-chain fatty acids into fatty acyl-CoA esters. ACSL1 preferentially uses palmitoleate, oleate and linoleate, and altered expression of ACSL1 is thought to increase accumulation of triglycerides in the liver.

ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.

Alternate Names

ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1

Entrez Gene IDs

2180 (Human)

Gene Symbol

ACSL1

UniProt

Additional ACSL1 Products

Product Documents for ACSL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACSL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ACSL1 Antibody - BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used ACSL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • ACSL1 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: brain tissue (hippocampus)
    Species: Rat
    Verified Customer | Posted 12/22/2017
    4% paraformaldehyde solution
    Name: S100A10 antibody Catalog #: NBP1-89370 Lot Number: A40997 Antibody Storage Conditions:-20℃ Application Tested: IHC-Fr Staining Expectations: co-labell A2 astrocytes with gfap Observation & Concerns: The background is very deep and the A2 astrocyte can’t be stained. Test Sample Information: Species & Treatments: SD rats & infrasound models Tissue: brain tissue (hippocampus) Fixative Composition: 4% paraformaldehyde solution Fixation Time & Temperature: 6 h or longer Tissue Processing: antigen retrieval, EDTA pH9.0, 95C, 15min Blocking Procedure: Blocking Solution: 3%BSA/5%BSA Time & Temperature: 0.5 or 1 h & room temperature Blocking Time: Click here to enter text. Primary Antibody Dilution: 1:25; 1:50; 1:100; 1:200; 1:500 Diluent Buffer: 3%BSA,0.3%Triton Time & Temperature: 12 h & 4℃ Washing Conditions: Wash Buffer Composition: 1 * PBS Method (Immersion, Rinsing etc.): Immersion Times/Washing: 3 * 10 min Repetitions: 3 times Secondary Antibody Manufacturer and Catalog #: CWBIO & CW0114S Secondary description: anti-rabbit secondary antibody is available, see section controls and additional images. Dilution: 1:200 Diluent Buffer: 1 * PBS(hoechest, PH=7.4) Incubation Time & Temperature: 2 h & room temperature Post-Secondary Washing: the same as post-primary washing Detection Method: Detection: DM4000 Controls: Positive Control: the anti-rabbit secondary antibody is available Negative Control: the production can not co-labell A2 ast
    ACSL1 Antibody - BSA Free NBP1-89270

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...