Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for ACSL1 Antibody - BSA Free
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein distribution across tissues to independent antibody NBP1-89271 (B).Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human soft tissues shows moderate to strong cytoplasmic positivity in adipocytes.Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270]
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.Immunocytochemistry/ Immunofluorescence: ACSL1 Antibody [NBP1-89270]
Staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.Applications for ACSL1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 3 using NBP1-89270 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ACSL1
ALCS1 is strongly expressed in the heart, kindey, liver, skeletal muscle, and erythroid cells, and to a lesser extent in lung, brain, placenta and pancreas. This protein is predominantly expressed during the early stages of erythroid development, and expression is weak in reticulocytes and young erythrocytes.
Alternate Names
ACS1LACS 2, Acyl-CoA synthetase 1, acyl-CoA synthetase long-chain family member 1, EC 6.2.1, FACL1EC 6.2.1.3, fatty-acid-Coenzyme A ligase, long-chain 1, LACS 1, LACSlong-chain 2, lignoceroyl-CoA synthase, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, long-chain fatty-acid-coenzyme A ligase 1, long-chain-fatty-acid--CoA ligase 1, Palmitoyl-CoA ligase 1, Palmitoyl-CoA ligase 2, paltimoyl-CoA ligase 1
Entrez Gene IDs
2180 (Human)
Gene Symbol
ACSL1
UniProt
Additional ACSL1 Products
Product Documents for ACSL1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ACSL1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ACSL1 Antibody - BSA Free (1)
3 out of 5
1 Customer Rating
Have you used ACSL1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: brain tissue (hippocampus)Species: RatVerified Customer | Posted 12/22/20174% paraformaldehyde solutionName: S100A10 antibody Catalog #: NBP1-89370 Lot Number: A40997 Antibody Storage Conditions:-20℃ Application Tested: IHC-Fr Staining Expectations: co-labell A2 astrocytes with gfap Observation & Concerns: The background is very deep and the A2 astrocyte can’t be stained. Test Sample Information: Species & Treatments: SD rats & infrasound models Tissue: brain tissue (hippocampus) Fixative Composition: 4% paraformaldehyde solution Fixation Time & Temperature: 6 h or longer Tissue Processing: antigen retrieval, EDTA pH9.0, 95C, 15min Blocking Procedure: Blocking Solution: 3%BSA/5%BSA Time & Temperature: 0.5 or 1 h & room temperature Blocking Time: Click here to enter text. Primary Antibody Dilution: 1:25; 1:50; 1:100; 1:200; 1:500 Diluent Buffer: 3%BSA,0.3%Triton Time & Temperature: 12 h & 4℃ Washing Conditions: Wash Buffer Composition: 1 * PBS Method (Immersion, Rinsing etc.): Immersion Times/Washing: 3 * 10 min Repetitions: 3 times Secondary Antibody Manufacturer and Catalog #: CWBIO & CW0114S Secondary description: anti-rabbit secondary antibody is available, see section controls and additional images. Dilution: 1:200 Diluent Buffer: 1 * PBS(hoechest, PH=7.4) Incubation Time & Temperature: 2 h & room temperature Post-Secondary Washing: the same as post-primary washing Detection Method: Detection: DM4000 Controls: Positive Control: the anti-rabbit secondary antibody is available Negative Control: the production can not co-labell A2 ast
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...