Activin RIB/ALK-4 Antibody (3U6I8)

Novus Biologicals | Catalog # NBP3-16106

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3U6I8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Activin RIB/ALK-4 (P36896). MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Activin RIB/ALK-4 Antibody (3U6I8)

Western Blot: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Western Blot: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Western Blot: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Western blot analysis of extracts of various cell lines, using Activin RIB/ALK-4 Rabbit mAb (NBP3-16106) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Immunohistochemistry of paraffin-embedded mouse brain using Activin RIB/ALK-4 Rabbit mAb (NBP3-16106) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Immunohistochemistry of paraffin-embedded rat testis using Activin RIB/ALK-4 Rabbit mAb (NBP3-16106) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Immunohistochemistry of paraffin-embedded human liver using Activin RIB/ALK-4 Rabbit mAb (NBP3-16106) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Activin RIB/ALK-4 Antibody (3U6I8)

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] -

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Mouse testis tissue using ACVR1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Activin RIB/ALK-4 Antibody (3U6I8)

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] -

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Mouse kidney tissue using ACVR1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Activin RIB/ALK-4 Antibody (3U6I8)

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] -

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Human colon tissue using ACVR1B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Activin RIB/ALK-4 Antibody (3U6I8)

Immunohistochemistry: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] -

Immunohistochemistry: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Activin RIB/ALK-4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Activin RIB/ALK-4 Antibody (3U6I8)

Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] -

Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody (3U6I8) [NBP3-16106] - Confocal imaging of NIH/3T3 cells using Activin RIB/ALK-4 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Activin RIB/ALK-4 Antibody (3U6I8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Activin RIB/ALK-4

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Long Name

Activin Receptor IB

Alternate Names

ActivinRIB, ACVR1B, ALK-4, ALK4

Gene Symbol

ACVR1B

Additional Activin RIB/ALK-4 Products

Product Documents for Activin RIB/ALK-4 Antibody (3U6I8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Activin RIB/ALK-4 Antibody (3U6I8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Activin RIB/ALK-4 Antibody (3U6I8)

There are currently no reviews for this product. Be the first to review Activin RIB/ALK-4 Antibody (3U6I8) and earn rewards!

Have you used Activin RIB/ALK-4 Antibody (3U6I8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...