ADNP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89236

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat, Rabbit

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG

Reactivity Notes

Use in Rabbit reported in scientific literature (PMID:35052632).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ADNP Antibody - BSA Free

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Analysis in human testis and liver tissues using NBP1-89236 antibody. Corresponding ADNP RNA-seq data are presented for the same tissues.
Western Blot: ADNP Antibody [NBP1-89236]

Western Blot: ADNP Antibody [NBP1-89236]

Western Blot: ADNP Antibody [NBP1-89236] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Western Blot: ADNP Antibody [NBP1-89236]

Western Blot: ADNP Antibody [NBP1-89236]

Western Blot: ADNP Antibody [NBP1-89236] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]

Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human liver shows no positivity in hepatocytes as expected.
ADNP Antibody

Western Blot Shows ADNP Specificity Using Knockdown Cell Line.

Western blot shows lysates of DMS 53 parental cell line and ADNP knockdown DMS 53 cell line (KD). Nitrocellulose membrane was probed with ADNP Antibody (Catalog # NBP1-89236) followed by HRP-conjugated secondary antibody. A specific band was detected for ADNP at approximately 135 kDa (as indicated) in the parental DMS 53 cell line, but is significantly reduced in knockdown DMS 53 cell line. Primary antibody concentration used: 0.4 μg/ml. The Ponceau stained transfer of the blot is shown. This experiment was conducted under reducing conditions. Image, protocol, and testing courtesy of YCharOS Inc. See ycharos.com for additional details.
ADNP Antibody

Detection of ADNP by Immunoprecipitation.

DMS 53 cell line lysates were prepared and immunoprecipitation was performed using 2.0 μg of ADNP Antibody (Catalog # NBP1-89236) pre-coupled to Dynabeads Protein A. Immunoprecipitated ADNP was detected in Western Blot with a Rabbit ADNP antibody used at 1/500. The Ponceau stained transfer of the blot is shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate; HC=antibody heavy chain. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).
ADNP Antibody - BSA Free

Western Blot: ADNP Antibody - BSA Free [NBP1-89236] -

Expression of ADNP in SIRC cells exposed to UV-B radiations. (A) Representative immunoblots of ADNP expression in SIRC cells following exposure to UV-B insult. The bar graph shows quantitative analysis of signals obtained by immunoblots resulting from three independent experiments. Relative band densities were quantified using ImageJ software. Protein levels are expressed as arbitrary units obtained following normalization to b-tubulin, which was used as loading control. Data represent means +/- SEM. *** p < 0.001 vs. CTRL, as determined by unpaired two-tailed Student t-test. (B) Representative photomicrographs showing ADNP expression (green) in SIRC cells exposed to UV-B radiations. Nuclei were stained with DAPI. Photomicrographs are representative results of fields taken randomly from each slide and scanned by confocal laser scanning microscopy (CLSM; Zeiss LSM700). In the right column, a thin section (0.3 um) with some SIRC cells showing ADNP in the euchromatic compartment of the nuclei is shown. Scale bar in the left and middle columns is 20 μm, and in the right column is 10 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ADNP Antibody - BSA Free

Immunohistochemistry: ADNP Antibody - BSA Free [NBP1-89236] -

Expression of ADNP and p63 in corneal epithelium. H&E staining and immunodetection of ADNP and p63 in human (A) and rabbit (B) cornea: (1) Epithelium, (2) Bowman’s membrane, (3) stroma. Original magnification ×200. Digital micrographs are representative results of fields taken in randomly selected slides and obtained using the Zeiss Axioplan light microscope (Carl Zeiss) fitted with a digital camera (AxioCam MRc5; Carl Zeiss); scale bar: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ADNP Antibody - BSA Free

Immunohistochemistry: ADNP Antibody - BSA Free [NBP1-89236] -

Expression of ADNP and p63 in corneal epithelium. H&E staining and immunodetection of ADNP and p63 in human (A) and rabbit (B) cornea: (1) Epithelium, (2) Bowman’s membrane, (3) stroma. Original magnification ×200. Digital micrographs are representative results of fields taken in randomly selected slides and obtained using the Zeiss Axioplan light microscope (Carl Zeiss) fitted with a digital camera (AxioCam MRc5; Carl Zeiss); scale bar: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ADNP Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ADNP Antibody [NBP1-89236]

Immunocytochemistry/ Immunofluorescence: ADNP Antibody [NBP1-89236]

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for ADNP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).

Knockdown Validated

Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ADNP

The activity-dependent neuroprotective protein (hADNP) gene is frequently amplified in many neoplasias, including breast, bladder, ovarian, pancreatic, and colon cancers. hADNP mRNA is abundantly expressed in distinct normal tissues, and high expression levels were encountered in malignant cells. hADNP is implicated in maintaining cell survival, perhaps through modulation of p53.

Long Name

Activity-dependent Neuroprotective Protein

Alternate Names

ADNP1

Gene Symbol

ADNP

Additional ADNP Products

Product Documents for ADNP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ADNP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ADNP Antibody - BSA Free

Customer Reviews for ADNP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ADNP Antibody - BSA Free and earn rewards!

Have you used ADNP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...