ADNP Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89236
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat, Rabbit
Cited:
Human, Mouse, Rat, Rabbit
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGSPFDPVFEVEPKISNDNPEEHVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQVSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEG
Reactivity Notes
Use in Rabbit reported in scientific literature (PMID:35052632).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ADNP Antibody - BSA Free
Western Blot: ADNP Antibody [NBP1-89236]
Western Blot: ADNP Antibody [NBP1-89236] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunocytochemistry/ Immunofluorescence: ADNP Antibody [NBP1-89236]
Immunocytochemistry/Immunofluorescence: ADNP Antibody [NBP1-89236] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human prostate shows strong nuclear positivity in glandular cells.Western Blot: ADNP Antibody [NBP1-89236]
Western Blot: ADNP Antibody [NBP1-89236] - Analysis in human cell line SH-SY5Y.Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236]
Immunohistochemistry-Paraffin: ADNP Antibody [NBP1-89236] - Staining of human liver shows no positivity in hepatocytes as expected.Western Blot Shows ADNP Specificity Using Knockdown Cell Line.
Western blot shows lysates of DMS 53 parental cell line and ADNP knockdown DMS 53 cell line (KD). Nitrocellulose membrane was probed with ADNP Antibody (Catalog # NBP1-89236) followed by HRP-conjugated secondary antibody. A specific band was detected for ADNP at approximately 135 kDa (as indicated) in the parental DMS 53 cell line, but is significantly reduced in knockdown DMS 53 cell line. Primary antibody concentration used: 0.4 μg/ml. The Ponceau stained transfer of the blot is shown. This experiment was conducted under reducing conditions. Image, protocol, and testing courtesy of YCharOS Inc. See ycharos.com for additional details.Detection of ADNP by Immunoprecipitation.
DMS 53 cell line lysates were prepared and immunoprecipitation was performed using 2.0 μg of ADNP Antibody (Catalog # NBP1-89236) pre-coupled to Dynabeads Protein A. Immunoprecipitated ADNP was detected in Western Blot with a Rabbit ADNP antibody used at 1/500. The Ponceau stained transfer of the blot is shown. SM=4% starting material; UB=4% unbound fraction; IP=immunoprecipitate; HC=antibody heavy chain. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).Western Blot: ADNP Antibody - BSA Free [NBP1-89236] -
Expression of ADNP in SIRC cells exposed to UV-B radiations. (A) Representative immunoblots of ADNP expression in SIRC cells following exposure to UV-B insult. The bar graph shows quantitative analysis of signals obtained by immunoblots resulting from three independent experiments. Relative band densities were quantified using ImageJ software. Protein levels are expressed as arbitrary units obtained following normalization to b-tubulin, which was used as loading control. Data represent means +/- SEM. *** p < 0.001 vs. CTRL, as determined by unpaired two-tailed Student t-test. (B) Representative photomicrographs showing ADNP expression (green) in SIRC cells exposed to UV-B radiations. Nuclei were stained with DAPI. Photomicrographs are representative results of fields taken randomly from each slide and scanned by confocal laser scanning microscopy (CLSM; Zeiss LSM700). In the right column, a thin section (0.3 um) with some SIRC cells showing ADNP in the euchromatic compartment of the nuclei is shown. Scale bar in the left and middle columns is 20 μm, and in the right column is 10 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: ADNP Antibody - BSA Free [NBP1-89236] -
Expression of ADNP and p63 in corneal epithelium. H&E staining and immunodetection of ADNP and p63 in human (A) and rabbit (B) cornea: (1) Epithelium, (2) Bowman’s membrane, (3) stroma. Original magnification ×200. Digital micrographs are representative results of fields taken in randomly selected slides and obtained using the Zeiss Axioplan light microscope (Carl Zeiss) fitted with a digital camera (AxioCam MRc5; Carl Zeiss); scale bar: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: ADNP Antibody - BSA Free [NBP1-89236] -
Expression of ADNP and p63 in corneal epithelium. H&E staining and immunodetection of ADNP and p63 in human (A) and rabbit (B) cornea: (1) Epithelium, (2) Bowman’s membrane, (3) stroma. Original magnification ×200. Digital micrographs are representative results of fields taken in randomly selected slides and obtained using the Zeiss Axioplan light microscope (Carl Zeiss) fitted with a digital camera (AxioCam MRc5; Carl Zeiss); scale bar: 20 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: ADNP Antibody - BSA Free [NBP1-89236] -
Expression of ADNP in SIRC cells exposed to UV-B radiations. (A) Representative immunoblots of ADNP expression in SIRC cells following exposure to UV-B insult. The bar graph shows quantitative analysis of signals obtained by immunoblots resulting from three independent experiments. Relative band densities were quantified using ImageJ software. Protein levels are expressed as arbitrary units obtained following normalization to b-tubulin, which was used as loading control. Data represent means +/- SEM. *** p < 0.001 vs. CTRL, as determined by unpaired two-tailed Student t-test. (B) Representative photomicrographs showing ADNP expression (green) in SIRC cells exposed to UV-B radiations. Nuclei were stained with DAPI. Photomicrographs are representative results of fields taken randomly from each slide and scanned by confocal laser scanning microscopy (CLSM; Zeiss LSM700). In the right column, a thin section (0.3 um) with some SIRC cells showing ADNP in the euchromatic compartment of the nuclei is shown. Scale bar in the left and middle columns is 20 μm, and in the right column is 10 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35052632), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ADNP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Immunoprecipitation
Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).
Knockdown Validated
Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ADNP
Long Name
Activity-dependent Neuroprotective Protein
Alternate Names
ADNP1
Gene Symbol
ADNP
Additional ADNP Products
Product Documents for ADNP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ADNP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ADNP Antibody - BSA Free
Customer Reviews for ADNP Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ADNP Antibody - BSA Free and earn rewards!
Have you used ADNP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...