Albumin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38174

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Albumin Antibody - BSA Free (NBP2-38174) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Albumin Antibody - BSA Free

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174] - Staining of human kidney, pancreas, placenta and prostate using Anti-Albumin antibody NBP2-38174 (A) shows similar protein distribution across tissues to independent antibody NBP2-38175 (B).
Western Blot: Albumin Antibody [NBP2-38174]

Western Blot: Albumin Antibody [NBP2-38174]

Western Blot: Albumin Antibody [NBP2-38174] - Analysis using Anti-ALB antibody NBP2-38174 (A) shows similar pattern to independent antibody NBP2-38175 (B).
Immunocytochemistry/ Immunofluorescence: Albumin Antibody [NBP2-38174]

Immunocytochemistry/ Immunofluorescence: Albumin Antibody [NBP2-38174]

Immunocytochemistry/Immunofluorescence: Albumin Antibody [NBP2-38174] - Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum & the Golgi apparatus.
Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174] - Staining of human prostate shows strong positivity in plasma.
Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174] - Staining of human kidney shows strong positivity in plasma.
Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174] - Staining of human pancreas shows strong positivity in plasma.
Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174]

Immunohistochemistry-Paraffin: Albumin Antibody [NBP2-38174] - Staining of human placenta shows strong positivity in plasma.

Applications for Albumin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Albumin

Albumin is a soluble, monomeric protein which comprises about one half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Mutations in this gene on chromosome 4 result in various anomalous proteins. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. The human albumin gene is 16,961 nucleotides long from the putative 'cap' site to the first poly(A) addition site. It is split into 15 exons which are symmetrically placed within the 3 domains that are thought to have arisen by triplication of a single primordial domain. Albumin is synthesized in the liver as preproalbumin which has an N terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Alternate Names

ALB

Gene Symbol

ALB

UniProt

Additional Albumin Products

Product Documents for Albumin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Albumin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Albumin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Albumin Antibody - BSA Free and earn rewards!

Have you used Albumin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies