ALDH1A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91657

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aldehyde Dehydrogenase 1-A3/ALDH1A3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN

Reactivity Notes

Rat (83%). Mouse reactivity reported in scientific literature (PMID: 26511661).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ALDH1A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining in human prostate and skeletal muscle tissues using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same tissues.
Western Blot: ALDH1A3 Antibody [NBP1-91657]

Western Blot: ALDH1A3 Antibody [NBP1-91657]

Western Blot: ALDH1A3 Antibody [NBP1-91657] - Analysis in human cell lines A-431 and Caco-2 using anti-ALDH1A3 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657]

Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657]

Immunocytochemistry/Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human prostate shows high expression.
Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Frozen: ALDH1A3 Antibody [NBP1-91657] - Aldh1a3 expression on E11.5 mouse embryo eye. Heat induced antigen retrieval at pH 6.0 was done for 20 minutes with mouse E11.5 coronal cryosection. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657]

Immunohistochemistry-Paraffin: ALDH1A3 Antibody [NBP1-91657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
ALDH1A3 Antibody

Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] -

Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP1-91657] - Cell proliferation during the oestrus cycle.(a) Protocol: adult (≥10-week-old) C57Bl6/J mice were administered CldU during pro-oestrus/early oestrus (blue arrows) & then IdU at metoestrus (red arrows) to detect sequential proliferation within the mammary gland. Immunofluorescent staining of adult mammary glands stained with CldU & IdU (b), & with ER, Aldh1a3 or K5 (c). Arrows indicate CldU+IdU+ cells, which demonstrate sequential cell division among mammary epithelial cells during the oestrus cycle. Representative image from four independent samples. Scale bars, 20 μm. (d) Representative flow cytometry dot plot showing the incorporation of EdU by NCL cells following injection of either oestrogen & progesterone or oil. A total of six independent adult (≥10-week-old) mice were analysed (four injected with oestrogen & progesterone, two injected with oil only). (e) NCL cells from adult (≥10-week-old) mice that are either in G0/G1 versus S/G2/M stages of the cell cycle were analysed by quantitative RT–PCR for ER alpha mRNA expression relative to Gapdh mRNA. Expression is relative to that of NCL G0/G1 cells. Mean±s.e.m of five independent mice. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26511661), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ALDH1A3 Antibody - BSA Free Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
ALDH1A3 Antibody - BSA Free Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
ALDH1A3 Antibody - BSA Free Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Analysis in human prostate and skeletal muscle tissues using NBP1-91657 antibody. Corresponding ALDH1A3 RNA-seq data are presented for the same tissues.
ALDH1A3 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
ALDH1A3 Antibody - BSA Free Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Immunohistochemistry: ALDH1A3 Antibody - BSA Free [NBP1-91657]

Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Applications for ALDH1A3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Frozen

Validated from a verified customer review

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-91657 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aldehyde Dehydrogenase 1-A3/ALDH1A3

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeq].

Long Name

Aldehyde Dehydrogenase 1 Family Member A3

Alternate Names

ALDH1A3, ALDH6, MCOP8, RALDH3

Entrez Gene IDs

220 (Human)

Gene Symbol

ALDH1A3

UniProt

P47895 (Human)

Additional Aldehyde Dehydrogenase 1-A3/ALDH1A3 Products

Product Documents for ALDH1A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ALDH1A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Adult Neurogenesis
Redox Enzymes

Citations for ALDH1A3 Antibody - BSA Free

Customer Reviews for ALDH1A3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ALDH1A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • ALDH1A3 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: E11.5 mouse embryo
    Species: Mouse
    Verified Customer | Posted 08/07/2018
    Aldh1a3 expression on E11.5 mouse embryo eye.
    Heat induced Antigen Retrieval at pH 6.0 was done for 20 minutes with mouse E11.5 coronal cryosection.
    ALDH1A3 Antibody - BSA Free NBP1-91657

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies