alpha-Sarcoglycan Antibody (3W3Q10)

Novus Biologicals | Catalog # NBP3-15896

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3W3Q10 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 288-387 of human alpha-Sarcoglycan (SGCA) (Q16586). VDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for alpha-Sarcoglycan Antibody (3W3Q10)

Western Blot: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Western Blot: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Western Blot: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Western blot analysis of extracts of various cell lines, using alpha-Sarcoglycan (SGCA) Rabbit mAb (NBP3-15896) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Immunohistochemistry of paraffin-embedded mouse heart using alpha-Sarcoglycan (SGCA) Rabbit mAb (NBP3-15896) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896]

Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (3W3Q10) [NBP3-15896] - Immunohistochemistry of paraffin-embedded rat heart using alpha-Sarcoglycan (SGCA) Rabbit mAb (NBP3-15896) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
alpha-Sarcoglycan Antibody (3W3Q10)

Immunocytochemistry/ Immunofluorescence: alpha-Sarcoglycan Antibody (3W3Q10) [alpha-Sarcoglycan] -

Immunocytochemistry/ Immunofluorescence: alpha-Sarcoglycan Antibody (3W3Q10) [alpha-Sarcoglycan] - Confocal imaging of paraffin-embedded Rat heart using alpha-Sarcoglycan Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
alpha-Sarcoglycan Antibody (3W3Q10)

Immunocytochemistry/ Immunofluorescence: alpha-Sarcoglycan Antibody (3W3Q10) [alpha-Sarcoglycan] -

Immunocytochemistry/ Immunofluorescence: alpha-Sarcoglycan Antibody (3W3Q10) [alpha-Sarcoglycan] - Confocal imaging of paraffin-embedded Mouse heart using alpha-Sarcoglycan Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for alpha-Sarcoglycan Antibody (3W3Q10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: alpha-Sarcoglycan

The dystrophin-glycoprotein complex (DGC) comprises a group of proteins that are critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Components of the DGC include dystrophin (MIM 300377), which is deficient in Duchenne muscular dystrophy (DMD; MIM 310200); syntrophins (e.g., MIM 600026); dystroglycans (MIM 128239); and sarcoglycans, such as adhalin, a 50-kD transmembrane protein (Roberds et al., 1993 [PubMed 8226900]).[supplied by OMIM]

Alternate Names

50-DAG, Adhalin, ADL, alphaSarcoglycan, DAG2, DMDA2, Dystroglycan-2, LGMD2D, SCARMD1, SGCA

Gene Symbol

SGCA

Additional alpha-Sarcoglycan Products

Product Documents for alpha-Sarcoglycan Antibody (3W3Q10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for alpha-Sarcoglycan Antibody (3W3Q10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for alpha-Sarcoglycan Antibody (3W3Q10)

There are currently no reviews for this product. Be the first to review alpha-Sarcoglycan Antibody (3W3Q10) and earn rewards!

Have you used alpha-Sarcoglycan Antibody (3W3Q10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...