Annexin V Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92940

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Annexin V Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human Annexin V (NP_001145.1). MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Knockout (KO) Validated Rabbit Annexin V Antibody - BSA Free (NBP2-92940) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Annexin V Antibody - BSA Free

Western Blot: Annexin V AntibodyBSA Free [NBP2-92940]

Western Blot: Annexin V AntibodyBSA Free [NBP2-92940]

Western Blot: Annexin V Antibody [NBP2-92940] - Analysis of extracts of various cell lines, using Annexin V at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: Annexin V Antibody - BSA Free [NBP2-92940]

Immunocytochemistry/ Immunofluorescence: Annexin V Antibody - BSA Free [NBP2-92940]

Immunocytochemistry/Immunofluorescence: Annexin V Antibody [NBP2-92940] - Analysis of HeLa cells using Annexin V. Blue: DAPI for nuclear staining.
Knockout Validated: Annexin V Antibody - BSA Free [NBP2-92940]

Western Blot: Annexin V Antibody - BSA Free [NBP2-92940]

Western Blot: Annexin V Antibody [NBP2-92940] - Analysis of extracts from normal (control) and ANxA5 knockout (KO) 293T cells, using Annexin V antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit.

Applications for Annexin V Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Annexin V

Annexin V is encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.

Alternate Names

ANX5, ANXA5, ANXV

Gene Symbol

ANXA5

Additional Annexin V Products

Product Documents for Annexin V Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Annexin V Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Coagulation

Customer Reviews for Annexin V Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Annexin V Antibody - BSA Free and earn rewards!

Have you used Annexin V Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Annexin V Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All

  • Q: I am studying apoptosis in adherent cells. Can I trypsinize the cells when using Annexin V-FITC to stain the cells?

    A: Adherent cells undergoing apoptosis automatically detach from the plate and may not require trypsinization. If there are attached cells, they may be trypsinized without affecting phosphatidylserine (PS).

  • Q: I do not have access to flow cytometer in my building. Can I stain for Annexin V and propidium iodide (PI), fix the cells, then analyze them in a different facility?

    A: Fixing the cells can affect cell permeability, enhancing the uptake of Annexin V and PI intracellularly. As a result, the profile of fixed cells may be different from unfixed cells, and the use of appropriate controls is recommended.

  • Q: I am studying apoptosis in adherent cells. Can I trypsinize the cells when using Annexin V-FITC to stain the cells?

    A: Adherent cells undergoing apoptosis automatically detach from the plate and may not require trypsinization. If there are attached cells, they may be trypsinized without affecting phosphatidylserine (PS).

  • Q: I do not have access to flow cytometer in my building. Can I stain for Annexin V and propidium iodide (PI), fix the cells, then analyze them in a different facility?

    A: Fixing the cells can affect cell permeability, enhancing the uptake of Annexin V and PI intracellularly. As a result, the profile of fixed cells may be different from unfixed cells, and the use of appropriate controls is recommended.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies