APOA1BP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30943

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for APOA1BP Antibody - BSA Free

Western Blot: APOA1BP Antibody [NBP2-30943]

Western Blot: APOA1BP Antibody [NBP2-30943]

Western Blot: APOA1BP Antibody [NBP2-30943] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-NAXE antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: APOA1BP Antibody [NBP2-30943]

Immunocytochemistry/ Immunofluorescence: APOA1BP Antibody [NBP2-30943]

Immunocytochemistry/Immunofluorescence: APOA1BP Antibody [NBP2-30943] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943] - Staining of human lymph node.
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NAXE antibody NBP2-30943 (A) shows similar protein distribution across tissues to independent antibody NBP2-30626 (B).
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943] - Staining of human testis.
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943] - Staining of human kidney.
Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943]

Immunohistochemistry-Paraffin: APOA1BP Antibody [NBP2-30943] - Staining of human cerebral cortex.

Applications for APOA1BP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APOA1BP

The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.

Alternate Names

AIBPAI-BP, apolipoprotein A-I binding protein, apolipoprotein A-I-binding protein, MGC119143, MGC119144, MGC119145, YjeF N-terminal domain-containing protein 1, yjeF_N1, YJEFN1apoA-I binding protein

Gene Symbol

NAXE

UniProt

Additional APOA1BP Products

Product Documents for APOA1BP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for APOA1BP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APOA1BP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APOA1BP Antibody - BSA Free and earn rewards!

Have you used APOA1BP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...