Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Name: Apolipoprotein A-II/ApoA2 Antibody (5F7U1)
Brand: Novus Biologicals
SKU: NBP3-16168
Price: 419 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16168

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5F7U1 expressed in HEK293

View all Apolipoprotein A-II/ApoA2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Apolipoprotein A-II/ApoA2 (NP_001634.1). MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Western Blot: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Western blot analysis of extracts of Human plasma cells, using Apolipoprotein A-II/ApoA2 antibody (NBP3-16168) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] -

Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Immunofluorescence analysis of mouse liver using Apolipoprotein A-II/ApoA2 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168]

Immunohistochemistry: Apolipoprotein A-II/ApoA2 Antibody (5F7U1) [NBP3-16168] - Analysis of rat liver using Apolipoprotein A-II/ApoA2 Rabbit mAb (NBP3-16168) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein A-II/ApoA2

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Alternate Names

Alp-2, APOA2, Apolipoprotein AII, Hdl-1

Gene Symbol

APOA2

Additional Apolipoprotein A-II/ApoA2 Products

Product Documents for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Obesity

Customer Reviews for Apolipoprotein A-II/ApoA2 Antibody (5F7U1)

There are currently no reviews for this product. Be the first to review Apolipoprotein A-II/ApoA2 Antibody (5F7U1) and earn rewards!

Have you used Apolipoprotein A-II/ApoA2 Antibody (5F7U1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image