Apolipoprotein CIII Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92734

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Apolipoprotein CIII Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1). MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Apolipoprotein CIII Antibody - BSA Free

Western Blot: Apolipoprotein CIII AntibodyAzide and BSA Free [NBP2-92734]

Western Blot: Apolipoprotein CIII AntibodyAzide and BSA Free [NBP2-92734]

Western Blot: Apolipoprotein CIII Antibody [NBP2-92734] - Analysis of extracts of various cell lines, using Apolipoprotein C3 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Rat spleen using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Human liver using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunohistochemistry-Paraffin: Apolipoprotein CIII Antibody [NBP2-92734] - Mouse spleen using Apolipoprotein C3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734]

Immunocytochemistry/Immunofluorescence: Apolipoprotein CIII Antibody [NBP2-92734] - Analysis of HepG2 cells using Apolipoprotein C3 Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.
Apolipoprotein CIII Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] -

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] - Immunofluorescence analysis of paraffin-embedded rat liver using Apolipoprotein CIII Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Apolipoprotein CIII Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] -

Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody - Azide and BSA Free [NBP2-92734] - Immunofluorescence analysis of paraffin-embedded mouse liver using Apolipoprotein CIII Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Apolipoprotein CIII Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:100-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein CIII

At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). This apo-lipoprotein antibody is derived from human plasma by density gradient ultracentrifugation and HPLC.

Alternate Names

APOC3, APOCIII, apo-CIII, ApoC-III, Apolipoprotein C3, apolipoprotein C-III, MGC150353

Gene Symbol

APOC3

Additional Apolipoprotein CIII Products

Product Documents for Apolipoprotein CIII Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein CIII Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Apolipoprotein CIII Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein CIII Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein CIII Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies