Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92026

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Apolipoprotein E R2/ApoE R2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human Apolipoprotein E R2/ApoE R2 (NP_004622.2). PLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Western Blot: Apolipoprotein E R2/ApoE R2 AntibodyBSA Free [NBP2-92026]

Western Blot: Apolipoprotein E R2/ApoE R2 AntibodyBSA Free [NBP2-92026]

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-92026] - Analysis of extracts of various cell lines, using Apolipoprotein E R2/ApoE R2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.
Immunohistochemistry: Apolipoprotein E R2/ApoE R2 Antibody - BSA Free [NBP2-92026]

Immunohistochemistry: Apolipoprotein E R2/ApoE R2 Antibody - BSA Free [NBP2-92026]

Immunohistochemistry: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-92026] - Immunofluorescence analysis of Human placenta using ApoER2/Apolipoprotein E R2/ApoE R2 antibody (NBP2-92026) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 -1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein E R2/ApoE R2

Apolipoprotein E Receptor 2 (ApoER2), also known as LRP8, is a Low-density lipoprotein receptor family member involved in endocytosis and signal transduction. Specifically, ApoER-2 is responsible for the cellular recognition and internalization of ApoE containing lipoproteins, including VLDL and HDL.

ApoER2 is expressed mainly in the brain, placenta, platelets and megakaryocytic cells, but not in the liver. LRP8 mutations can cause myocardial infarction type 1 (MCI1), a condition characterized by the irreversible necrosis of heart muscle secondary to prolonged ischemia. ApoER2 may also play a role in debilitating neurodegenerative diseases such as schizophrenia and Alzheimer's disease.

ApoER2 antibodies are useful tools for studying certian cardiac and neurodegenerative diseases.

Long Name

Apolipoprotein E Receptor 2

Alternate Names

ApoER2, Lr8b, LRP-8, LRP8

Gene Symbol

LRP8

Additional Apolipoprotein E R2/ApoE R2 Products

Product Documents for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glucose Homeostasis
Obesity

Customer Reviews for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Apolipoprotein E R2/ApoE R2 Antibody - BSA Free and earn rewards!

Have you used Apolipoprotein E R2/ApoE R2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies