Aquaporin 1/AQP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35493

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin 1/AQP1 (AQP1) (NP_932766.1).

Sequence:
AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin 1/AQP1 Antibody - BSA Free

Aquaporin 1/AQP1 Antibody

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Immunohistochemistry analysis of paraffin-embedded Human kidney using Aquaporin 1/AQP1Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Aquaporin 1/AQP1 Antibody

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using Aquaporin 1/AQP1Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Aquaporin 1/AQP1 Antibody

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Immunohistochemistry: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Aquaporin 1/AQP1Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Aquaporin 1/AQP1 Antibody

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Immunofluorescence analysis of paraffin-embedded rat kidney using Aquaporin 1/AQP1Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Aquaporin 1/AQP1 Antibody

Western Blot: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Western Blot: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Western blot analysis of various lysates using Aquaporin 1/AQP1Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Aquaporin 1/AQP1 Antibody

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP3-35493] -

Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP3-35493] - Immunofluorescence analysis of paraffin-embedded human kidney using Aquaporin 1/AQP1Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Aquaporin 1/AQP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin 1/AQP1

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Thisgene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayerspanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant inerythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involvingimbalance in ocular fluid movement. (provided by RefSeq)

Alternate Names

AQP1, CHIP28, CO

Gene Symbol

AQP1

Additional Aquaporin 1/AQP1 Products

Product Documents for Aquaporin 1/AQP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin 1/AQP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Aquaporin 1/AQP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin 1/AQP1 Antibody - BSA Free and earn rewards!

Have you used Aquaporin 1/AQP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aquaporin 1/AQP1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.

    A:

    A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...