Argininosuccinate Lyase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38249

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Argininosuccinate Lyase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 289-464 of human Argininosuccinate Lyase (NP_000039.2).

Sequence:
NPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Argininosuccinate Lyase Antibody - BSA Free

Argininosuccinate Lyase Antibody

Western Blot: Argininosuccinate Lyase Antibody [NBP3-38249] -

Western Blot: Argininosuccinate Lyase Antibody [NBP3-38249] - Western blot analysis of various lysates using Argininosuccinate Lyase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Argininosuccinate Lyase Antibody

Western Blot: Argininosuccinate Lyase Antibody [NBP3-38249] -

Western Blot: Argininosuccinate Lyase Antibody [NBP3-38249] - Western blot analysis of various lysates using Argininosuccinate Lyase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Argininosuccinate Lyase Antibody

Immunohistochemistry: Argininosuccinate Lyase Antibody [NBP3-38249] -

Immunohistochemistry: Argininosuccinate Lyase Antibody [NBP3-38249] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Argininosuccinate Lyase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Argininosuccinate Lyase Antibody

Immunohistochemistry: Argininosuccinate Lyase Antibody [NBP3-38249] -

Immunohistochemistry: Argininosuccinate Lyase Antibody [NBP3-38249] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Argininosuccinate Lyase Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Argininosuccinate Lyase Antibody

Immunocytochemistry/ Immunofluorescence: Argininosuccinate Lyase Antibody [NBP3-38249] -

Immunocytochemistry/ Immunofluorescence: Argininosuccinate Lyase Antibody [NBP3-38249] - Immunofluorescence analysis of NIH-3T3 cells using Argininosuccinate Lyase Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Argininosuccinate Lyase Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Argininosuccinate Lyase

Argininosuccinate Lyase encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

argininosuccinase, argininosuccinate lyase, Arginosuccinase, ASAL, EC 4.3.2.1

Gene Symbol

ASL

Additional Argininosuccinate Lyase Products

Product Documents for Argininosuccinate Lyase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Argininosuccinate Lyase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Argininosuccinate Lyase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Argininosuccinate Lyase Antibody - BSA Free and earn rewards!

Have you used Argininosuccinate Lyase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies