ASC/TMS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48925

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ASC Primary Antibodies »

Product Specifications

Immunogen

This ASC/TMS1 Antibody was developed against a recombinant protein corresponding to amino acids: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ASC/TMS1 Antibody - BSA Free (NBP2-48925) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ASC/TMS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Analysis in human spleen and skeletal muscle tissues. Corresponding ASC/TMS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human liver, lung, skeletal muscle and spleen using Anti-ASC/TMS1 antibody NBP2-48925 (A) shows similar protein distribution across tissues to independent antibody NBP2-49133 (B).
Immunocytochemistry/ Immunofluorescence: ASC/TMS1 Antibody [NBP2-48925]

Immunocytochemistry/ Immunofluorescence: ASC/TMS1 Antibody [NBP2-48925]

Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP2-48925] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli & cytosol.
Western Blot: ASC/TMS1 Antibody [NBP2-48925]

Western Blot: ASC/TMS1 Antibody [NBP2-48925]

Western Blot: ASC/TMS1 Antibody [NBP2-48925] - Analysis in human spleen tissue.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Immunohistochemical staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925]

Immunohistochemistry-Paraffin: ASC/TMS1 Antibody [NBP2-48925] - Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Applications for ASC/TMS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ASC

ASC (apoptosis-associated speck-like protein containing a CARD), also known as TMS1 (target of methylation-induced silencing), was first identified in 1999 as a protein that forms aggregates, or specks, during retinoic acid-induced apoptosis in a human leukemia cell line (1). Furthermore, it was discovered to have a role as a tumor suppressor as methylation silences ASC/TMS1 expression in many tumors (2-5). ASC/TMS1 is synthesized as a 195-amino acid (aa) protein with a theoretical weight of 22 kDa. Structurally the protein contains a N-terminal PYD (pyrin domain) and C-terminal CARD (caspase-recruitment domain) (1-4). Historically, CARD and PYD-containing proteins are known to have crucial functions in regulating apoptosis and immune response pathways (2-5). Furthermore, mutations in many CARD and PYD-containing proteins have been linked to various cancers and inflammatory diseases (2-5). Given its immune response role, it is not surprising that ASC/TMS1 is typically highly expressed in immune cells, specifically in neutrophils and cells of the macrophage/monocyte lineage (5). Additionally, it is expressed in many normal epithelial cell types (4,5).

In regard to immune and inflammatory response, ASC/TMS1 is involved in inflammasome function (3-4). The inflammasome is a multiprotein complex that responds to cellular stress or pathogens and activates inflammatory responses. Specifically, ASC/TMS1 helps assemble the NLRP3 inflammasome complex which then activates caspase-1, followed by stimulation of proinflammatory cytokines including IL-1b and IL-18 (3-4). In terms of the role in regulating apoptosis, multiple studies have revealed that the ASC/TMS1 gene is hypermethylated in many cancers including breast, lung, glioblastomas, and melanomas (2-5). The increased methylation results in decreased gene expression, or silencing, allowing those cancer cells to escape apoptosis (2-5).

References

1. Masumoto, J., Taniguchi, S., Ayukawa, K., Sarvotham, H., Kishino, T., Niikawa, N., Hidaka, E., Katsuyama, T., Higuchi, T., & Sagara, J. (1999). ASC, a novel 22-kDa protein, aggregates during apoptosis of human promyelocytic leukemia HL-60 cells. The Journal of biological chemistry, 274(48), 33835-33838. https://doi.org/10.1074/jbc.274.48.33835

2. McConnell, B. B., & Vertino, P. M. (2004). TMS1/ASC: the cancer connection. Apoptosis: an international journal on programmed cell death. https://doi.org/10.1023/B:APPT.0000012117.32430.0c

3. Salminen, A., Kauppinen, A., Hiltunen, M., & Kaarniranta, K. (2014). Epigenetic regulation of ASC/TMS1 expression: potential role in apoptosis and inflammasome function. Cellular and molecular life sciences : CMLS. https://doi.org/10.1007/s00018-013-1524-9

4. Protti, M. P., & De Monte, L. (2020). Dual Role of Inflammasome Adaptor ASC in Cancer. Frontiers in cell and developmental biology. https://doi.org/10.3389/fcell.2020.00040

5. Parsons, M. J., & Vertino, P. M. (2006). Dual role of TMS1/ASC in death receptor signaling. Oncogene. https://doi.org/10.1038/sj.onc.1209684

Long Name

Apoptosis-Associated Speck-Like Protein Containing A CARD

Alternate Names

CARD5, PYCARD, TMS1

Gene Symbol

PYCARD

Additional ASC Products

Product Documents for ASC/TMS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ASC/TMS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASC/TMS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ASC/TMS1 Antibody - BSA Free and earn rewards!

Have you used ASC/TMS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies