ATP5A Antibody (6M3B8)

Novus Biologicals | Catalog # NBP3-15355

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6M3B8 expressed in HEK293
View all ATP5A Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A (P25705). VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ATP5A Antibody (6M3B8)

Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355]

Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355]

Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355] - Analysis of extracts of various cell lines, using ATP5A Rabbit mAb (NBP3-15355) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
ATP5A Antibody (6M3B8)

Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] -

Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] - ATP5A Antibodies (NBP3-15355), ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times. Image from verified customer review.
ATP5A Antibody (6M3B8)

Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] -

Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATP5A Antibody (6M3B8)

Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -

Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -Rat brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ATP5A Antibody (6M3B8)

Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -

Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] - Mouse brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ATP5A Antibody (6M3B8)

Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] -

Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ATP5A Antibody (6M3B8)

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ATP5A Antibody (6M3B8)

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of NIH/3T3 cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ATP5A Antibody (6M3B8)

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ATP5A Antibody (6M3B8)

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] -

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of HeLa cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATP5A Antibody (6M3B8)

Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] -

Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] - Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A antibody. Western blot was performed from the immunoprecipitate using ATP5A antibody at a dilution of 1:1000.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
ATP5A Antibody (6M3B8)

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] -

Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for ATP5A Antibody (6M3B8)

Application
Recommended Usage

ELISA

,Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:2000

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Immunoprecipitation

0.5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:1000 - 1:6000
Application Notes
See Simple Western Antibody Database for Simple Western validation

Reviewed Applications

Read 1 review rated 5 using NBP3-15355 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP5A

ATP5A encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the same protein have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16. [provided by RefSeq]

Long Name

ATP5A1

Alternate Names

ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 co, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2, ATP sythase (F1-ATPase) alpha subunit, ATP5A, ATP5A1, ATP5AL2, ATP5AMOM2, ATPM, ATPMATP synthase subunit alpha, mitochondrial, cardiac muscle, COXPD22, EC 3.6.3, EC 3.6.3.14, epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, MC5DN4A, MC5DN4B, mitochondrial ATP synthetase, oligomycin-resistant, MOM2, OMR, ORM, ORMATP synthase alpha chain, mitochondrial

Gene Symbol

ATP5F1A

Additional ATP5A Products

Product Documents for ATP5A Antibody (6M3B8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATP5A Antibody (6M3B8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATP5A Antibody (6M3B8) (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ATP5A Antibody (6M3B8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • ATP5A Antibody (6M3B8)
    Name: Anonymous
    Application: Simple Western
    Sample Tested: human brain lysate
    Species: Human
    Verified Customer | Posted 04/06/2023
    ATP5A Antibodies NBP3-15355, ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times.
    ATP5A Antibody (6M3B8) NBP3-15355
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies