ATP6V0A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89342

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V0A1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Analysis in human cerebral cortex and tonsil tissues. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues.
Western Blot: ATP6V0A1 Antibody [NBP1-89342]

Western Blot: ATP6V0A1 Antibody [NBP1-89342]

ATP6V0A1-Antibody-Western-Blot-NBP1-89342-img0018.jpg
Western Blot: ATP6V0A1 Antibody [NBP1-89342]

Western Blot: ATP6V0A1 Antibody [NBP1-89342]

ATP6V0A1-Antibody-Western-Blot-NBP1-89342-img0017.jpg
Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342]

Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342]

Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human kidney shows strong cytoplasmic postivity in cells in tubules.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342]

Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebellum shows strong cytoplasmic postivity in cells in granular layer.
ATP6V0A1 Antibody

Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] -

Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric quantitation of V0a1 in isolated plasma membrane fraction from WT & Cln1−/− mouse brain (n=4, *P<0.05). (b) Localization of V0a1 in the plasma membrane in WT & Cln1−/− neurons using Na+, K+-ATPase as membrane marker. Colocalization between V0a1 & Na+, K+-ATPase was assessed using the Manders' colocalization coefficients M1 & M2 (n=18 for WT & n=22 for Cln1−/−, ***P<0.001; scale bars, 5 μm. (c) Pull-down assay with AP-3 antibody detects V0a1 in total brain lysates from WT & Cln1−/− mouse brain (n=4, *P<0.05). (d) Confocal imaging of PLA reaction showing V0a1 & AP-3 delta interaction in neurons isolated from WT & Cln1−/−mouse brain (n=188 for WT & n=158 for Cln1−/−, ***P<0.001); scale bars, 20 μm. (e) Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) & bromopalmitate-treated (lane 2) WT brain slices to detect V0a1 & its densitometric quantitation (n=4, *P<0.05). (f) HEK-293 cells were transfected with WT GFP-V0a1 & GFP-V0a1-Cys25Ser mutant construct, & pull-down experiments were conducted with AP-3 antibody to detect GFP-V0a1,*P<0.05(n=4). Image collected & cropped by CiteAb from the following publication (https://www.nature.com/articles/ncomms14612), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ATP6V0A1 Antibody

Western Blot: ATP6V0A1 Antibody [NBP1-89342] -

Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric quantitation of V0a1 in isolated plasma membrane fraction from WT & Cln1−/− mouse brain (n=4, *P<0.05). (b) Localization of V0a1 in the plasma membrane in WT & Cln1−/− neurons using Na+, K+-ATPase as membrane marker. Colocalization between V0a1 & Na+, K+-ATPase was assessed using the Manders' colocalization coefficients M1 & M2 (n=18 for WT & n=22 for Cln1−/−, ***P<0.001; scale bars, 5 μm. (c) Pull-down assay with AP-3 antibody detects V0a1 in total brain lysates from WT & Cln1−/− mouse brain (n=4, *P<0.05). (d) Confocal imaging of PLA reaction showing V0a1 & AP-3 delta interaction in neurons isolated from WT & Cln1−/−mouse brain (n=188 for WT & n=158 for Cln1−/−, ***P<0.001); scale bars, 20 μm. (e) Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) & bromopalmitate-treated (lane 2) WT brain slices to detect V0a1 & its densitometric quantitation (n=4, *P<0.05). (f) HEK-293 cells were transfected with WT GFP-V0a1 & GFP-V0a1-Cys25Ser mutant construct, & pull-down experiments were conducted with AP-3 antibody to detect GFP-V0a1,*P<0.05(n=4). Image collected & cropped by CiteAb from the following publication (https://www.nature.com/articles/ncomms14612), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ATP6V0A1 Antibody

Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] -

Immunocytochemistry/ Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - In Cln1−/− mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3.(a) Western blot analysis & densitometric quantitation of V0a1 in isolated plasma membrane fraction from WT & Cln1−/− mouse brain (n=4, *P<0.05). (b) Localization of V0a1 in the plasma membrane in WT & Cln1−/− neurons using Na+, K+-ATPase as membrane marker. Colocalization between V0a1 & Na+, K+-ATPase was assessed using the Manders' colocalization coefficients M1 & M2 (n=18 for WT & n=22 for Cln1−/−, ***P<0.001; scale bars, 5 μm. (c) Pull-down assay with AP-3 antibody detects V0a1 in total brain lysates from WT & Cln1−/− mouse brain (n=4, *P<0.05). (d) Confocal imaging of PLA reaction showing V0a1 & AP-3 delta interaction in neurons isolated from WT & Cln1−/−mouse brain (n=188 for WT & n=158 for Cln1−/−, ***P<0.001); scale bars, 20 μm. (e) Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) & bromopalmitate-treated (lane 2) WT brain slices to detect V0a1 & its densitometric quantitation (n=4, *P<0.05). (f) HEK-293 cells were transfected with WT GFP-V0a1 & GFP-V0a1-Cys25Ser mutant construct, & pull-down experiments were conducted with AP-3 antibody to detect GFP-V0a1,*P<0.05(n=4). Image collected & cropped by CiteAb from the following publication (https://www.nature.com/articles/ncomms14612), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ATP6V0A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY license.
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-89342 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V0A1

ATP6V0A1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three A subunit proteins and the encoded protein is associated with clathrin-coated vesicles. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

a1, ATP6N1, ATP6N1AATPase, H+ transporting, lysosomal non-catalytic accessory protein 1(110/116kD), ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalyticaccessory protein 1A (110/116kD), ATPase, H+ transporting, lysosomal V0 subunit a isoform 1, ATPase, H+ transporting, lysosomal V0 subunit a1, Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, DKFZp781J1951, Stv1, Vacuolar adenosine triphosphatase subunit Ac116, Vacuolar proton pump subunit 1, vacuolar proton pump, subunit 1, vacuolar proton translocating ATPase 116 kDa subunit A, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1, vacuolar-type H(+)-ATPase 115 kDa subunit, V-ATPase 116 kDa, V-ATPase 116 kDa isoform a1, Vph1, VPP1H(+)-transporting two-sector ATPase, 116 kDa accessory protein A1, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 1

Gene Symbol

ATP6V0A1

Additional ATP6V0A1 Products

Product Documents for ATP6V0A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATP6V0A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATP6V0A1 Antibody - BSA Free

Customer Reviews for ATP6V0A1 Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ATP6V0A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 2 of 2 reviews Showing All
Filter By:
  • Nice antibody to detect endogenous V0
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Brain (cortex) tissue
    Species: Mouse
    Verified Customer | Posted 02/03/2025
    A nice ATP6V0A1 antibody
    1:2000 dilution at 4 degrees overnight to detect endogenous V0A1 from mouse (20 ug total protein).
    ATP6V0A1 Antibody - BSA Free NBP1-89342
  • ATP6V0A1 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Mouse embryonic fibroblasts
    Species: Mouse
    Verified Customer | Posted 10/13/2020
    MEFs stained for ATP6v0A1 (green&amp;#41 and nuclei (DAPI). Antibody diluted 1:200 and incubated for 1 h RT.
    ATP6V0A1 Antibody - BSA Free NBP1-89342

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...