Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
Novus Biologicals | Catalog # NBP3-33325
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Rabbit IgG Clone # 2C5S5
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atrial Natriuretic Peptide/ANP (NP_006163.1).
Sequence:
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG
Sequence:
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
Western Blot: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] -
Western Blot: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Atrial Natriuretic Peptide/ANP using Atrial Natriuretic Peptide/ANP Rabbit mAb at 1:5000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] -
Immunocytochemistry/ Immunofluorescence: Atrial Natriuretic Peptide/ANP Antibody (2C5S5) [NBP3-33325] - Confocal imaging of paraffin-embedded mouse heart using Atrial Natriuretic Peptide/ANP Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:2000 - 1:6000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Atrial Natriuretic Peptide/ANP
Alternate Names
ANF, ANP, Cardionatrin, NPPA, PND
Gene Symbol
NPPA
Additional Atrial Natriuretic Peptide/ANP Products
Product Documents for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Atrial Natriuretic Peptide/ANP Antibody (2C5S5)
There are currently no reviews for this product. Be the first to review Atrial Natriuretic Peptide/ANP Antibody (2C5S5) and earn rewards!
Have you used Atrial Natriuretic Peptide/ANP Antibody (2C5S5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...