Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35467

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).

Sequence:
LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Atrial Natriuretic Peptide/ANP Antibody

Immunohistochemistry: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] -

Immunohistochemistry: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Atrial Natriuretic Peptide/ANP Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Atrial Natriuretic Peptide/ANP Antibody

Immunohistochemistry: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] -

Immunohistochemistry: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using Atrial Natriuretic Peptide/ANP Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Atrial Natriuretic Peptide/ANP Antibody

Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] -

Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP3-35467] - Western blot analysis of lysates from Mouse heart, using Atrial Natriuretic Peptide/ANP Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Atrial Natriuretic Peptide/ANP

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Alternate Names

ANF, ANP, Cardionatrin, NPPA, PND

Gene Symbol

NPPA

Additional Atrial Natriuretic Peptide/ANP Products

Product Documents for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Atrial Natriuretic Peptide/ANP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Atrial Natriuretic Peptide/ANP Antibody - BSA Free and earn rewards!

Have you used Atrial Natriuretic Peptide/ANP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...