BACE-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62416

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BACE-1 Antibody - BSA Free

Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416] - Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.
Immunocytochemistry/ Immunofluorescence: BACE-1 Antibody [NBP1-62416]

Immunocytochemistry/ Immunofluorescence: BACE-1 Antibody [NBP1-62416]

Immunocytochemistry/Immunofluorescence: BACE-1 Antibody [NBP1-62416] - Mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).
Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416]

Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416]

Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human testis tissue at an antibody concentration of 4-8ug/ml.
Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane
Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416] - Astrocytes, Antibody Titration: 0.2-1 ug/ml
Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416]

Western Blot: BACE-1 Antibody [NBP1-62416] - Mouse WT brain and Rat brain, concentration 2ug/ml.
Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416]

Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416]

Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.

Applications for BACE-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

2-10 ug/ml

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BACE-1

Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein encoded by this gene. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. Four transcript variants encoding different isoforms have been described for this gene.

Long Name

beta-site Ayloid Precursor Protein Cleaving Enzyme 1

Alternate Names

BACE1

Gene Symbol

BACE1

UniProt

Additional BACE-1 Products

Product Documents for BACE-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BACE-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for BACE-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BACE-1 Antibody - BSA Free and earn rewards!

Have you used BACE-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies