BAG5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86065

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: INKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAG5 Antibody - BSA Free

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065] - Staining in human testis and skeletal muscle tissues.. Corresponding BAG5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065] - Staining of human testis shows moderate positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065] - Staining of human prostate shows very weak cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065]

Immunohistochemistry-Paraffin: BAG5 Antibody [NBP1-86065] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
BAG5 Antibody - BSA Free Western Blot: BAG5 Antibody - BSA Free [NBP1-86065]

Western Blot: BAG5 Antibody - BSA Free [NBP1-86065]

Analysis in human cell line Daudi.
BAG5 Antibody - BSA Free Western Blot: BAG5 Antibody - BSA Free [NBP1-86065]

Western Blot: BAG5 Antibody - BSA Free [NBP1-86065]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
BAG5 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: BAG5 Antibody [NBP1-86065]

Immunocytochemistry/ Immunofluorescence: BAG5 Antibody [NBP1-86065]

Staining of human cell line A-431 shows localization to vesicles.

Applications for BAG5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BAG5

The BAG (Bcl-2-associated anthanogene) proteins are a family of chaperone regulators that modulate a number of diverse processes including proliferation, survival, stress responses, tumorigenesis, neuronal differentiation, growth arrest and apoptosis (reviewed Takayama and Reed, 2001; Doong et al, 2002, and Doukhanina et al. 2006). BAG proteins have been characterized as co-chaperones and interact with the chaperone heat shock proteins 70, both constitutive Hsc70 and inducible Hsp70. BAG proteins bind through their BAG domain to the ATPase domain of Hsc70/Hsp70, and can modulate either positively or negatively the functions of the Hsc70/Hsp70 chaperone proteins. The BAG domain has been shown to contribute to the anti-apoptotic activity of BAG-family proteins. The anti-apoptotic activities of BAG-family proteins may be dependent on their interactions with Hsc70/Asp70 and/or binding to Bcl-2. In addition to the conserved BAG domain, BAG-family proteins also contain additional domains which enable them to interact with specific target proteins or to target them to specific locations within cells. The BAG family contains at least six family members, including BAG-1 and its various isoforms [including BAG-1S, BAG-1M (RAP46/HAP46), and BAG-1L, BAG2, BAG3 (CAIR-1; Bis,), BAG4 (SODD), BAG5 and BAG6 (Scythe, BAT3). The following amino acids (aa) lengths and molecular weights (kDa) have been described for human BAG proteins (reviewed in Takayama et al, 2001 and Doong et al, 2002): BAG-1 (230 aa., 34 kDa), BAG-1S (219 aa, 29 kDa), BAG-1M (274 aa, 46 kDa), BAG-1L (345 aa, 52 kDa), BAG-2 [212 aa; 24 kDa (Arndt et al. 2005)], BAG-3 (575 aa, 74 kDa), BAG-4 (456 aa; 60 kDa), BAG-5 ([442 aa; 51 kDa (Kalia et al. 2004)], and BAG-6 (1129 aa; 150 kDa).

Alternate Names

BAG family molecular chaperone regulator 5, BAG-5, BAG-family molecular chaperone regulator-5, Bcl-2-associated athanogene 5, BCL2-associated athanogene 5, KIAA0873

Gene Symbol

BAG5

Additional BAG5 Products

Product Documents for BAG5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BAG5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAG5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BAG5 Antibody - BSA Free and earn rewards!

Have you used BAG5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...