BAIAP2L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89537

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAIAP2L1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537]

Immunocytochemistry/ Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537]

Immunocytochemistry/Immunofluorescence: BAIAP2L1 Antibody [NBP1-89537] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining in human duodenum and skeletal muscle tissues using anti-BAIAP2L1 antibody. Corresponding BAIAP2L1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537]

Immunohistochemistry-Paraffin: BAIAP2L1 Antibody [NBP1-89537] - Staining of human skeletal muscle shows low expression as expected.
BAIAP2L1 Antibody - BSA Free Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Analysis in human cell line CAPAN-2.
BAIAP2L1 Antibody - BSA Free Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Analysis using Anti-BAIAP2L1 antibody NBP1-89537 (A) shows similar pattern to independent antibody NBP1-89542 (B).
BAIAP2L1 Antibody - BSA Free Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Western Blot: BAIAP2L1 Antibody - BSA Free [NBP1-89537]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for BAIAP2L1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BAIAP2L1

BAIAP2L1 (Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1) may function as an adapter protein. It contains an IRSp53/MIM homology domain (IMD) that bundles actin filaments, and interacts with the small GTPase Rac.

Alternate Names

BAI1-associated protein 2-like 1, BAI1-associated protein 2-like protein 1, brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1, FLJ42275, IRTKSInsulin receptor tyrosine kinase substrate

Gene Symbol

BAIAP2L1

Additional BAIAP2L1 Products

Product Documents for BAIAP2L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BAIAP2L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAIAP2L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BAIAP2L1 Antibody - BSA Free and earn rewards!

Have you used BAIAP2L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...