BCL7B Antibody (6D2) - Azide and BSA Free

Novus Biologicals | Catalog # H00009275-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6D2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES

Specificity

BCL7B - B-cell CLL/lymphoma 7B

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for BCL7B Antibody (6D2) - Azide and BSA Free

Western Blot: BCL7B Antibody (6D2) [H00009275-M01]

Western Blot: BCL7B Antibody (6D2) [H00009275-M01]

Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - BCL7B monoclonal antibody (M01), clone 6D2. Analysis of BCL7B expression in MCF-7.
Immunocytochemistry/ Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01]

Immunocytochemistry/ Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01]

Immunocytochemistry/Immunofluorescence: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of monoclonal antibody to BCL7B on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: BCL7B Antibody (6D2) [H00009275-M01]

Western Blot: BCL7B Antibody (6D2) [H00009275-M01]

Western Blot: BCL7B Antibody (6D2) [H00009275-M01] - Analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.Lane 1: BCL7B transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
ELISA: BCL7B Antibody (6D2) [H00009275-M01]

ELISA: BCL7B Antibody (6D2) [H00009275-M01]

ELISA: BCL7B Antibody (6D2) [H00009275-M01] - Detection limit for recombinant GST tagged BCL7B is approximately 0.1ng/ml as a capture antibody.

Applications for BCL7B Antibody (6D2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: BCL7B

The protein encoded by this gene contains a region that is highly similar to the N-terminal segment of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. The function of this gene has not yet been determined.

Alternate Names

Allergen Hom s 3, B-cell CLL/lymphoma 7 protein family member B, B-cell CLL/lymphoma 7B

Entrez Gene IDs

9275 (Human)

Gene Symbol

BCL7B

OMIM

605846 (Human)

Additional BCL7B Products

Product Documents for BCL7B Antibody (6D2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BCL7B Antibody (6D2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BCL7B Antibody (6D2) - Azide and BSA Free

Customer Reviews for BCL7B Antibody (6D2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review BCL7B Antibody (6D2) - Azide and BSA Free and earn rewards!

Have you used BCL7B Antibody (6D2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...