BDNF Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59304

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Monkey, Rhesus Macaque

Cited:

Mouse, Primate - Macaca mulatta (Rhesus Macaque)

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BDNF Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for BDNF Antibody - BSA Free

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

BDNF-Antibody-Western-Blot-NBP1-59304-img0009.jpg
Immunohistochemistry: BDNF Antibody [NBP1-59304]

Immunohistochemistry: BDNF Antibody [NBP1-59304]

Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spinal cord. Concentration 1:200
Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.
Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304]

Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: BDNF Antibody [NBP1-59304]

Immunohistochemistry: BDNF Antibody [NBP1-59304]

Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concentration1:300.
BDNF Antibody

Western Blot: BDNF Antibody [NBP1-59304] -

Western Blot: BDNF Antibody [NBP1-59304] - Simvastatin treatment increases BDNF expression in primary cortical neurons of AS mice. (A) Primary cultured cortical neurons prepared from wild type & AS embryos were treated with 5 μM simvastatin at DIV14 for 12 h. Neurons were then fixed & processed for double immunofluorescence staining using Ube3a & BDNF antibodies. Representative images were shown. About 12 immunostained neurons in each group were checked for BDNF expression, fluorescence intensity in each cell was quantified & compared. Scale bar, 50 μm. (B) Immunoblot analysis of matured BDNF levels in simvastatin treated primary cortical neurons as described above. (C) Band intensity of the mature BDNF was quantified & normalized to Tuj1 (BDNF/Tuj1). Values are mean ± SD; n = 3. The ‘a’ point P < 0.05 compared to vehicle treated wild type group & “b” denote P < 0.05 with respect to vehicle treated AS group (one way ANOVA with Holm–Sidak post hoc test). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31849603), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for BDNF Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200- 1:500

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31849603).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BDNF

BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

Long Name

Brain-derived Neurotrophic Factor

Alternate Names

Abrineurin, ANON2, BULN2, Neurotrophin

Gene Symbol

BDNF

UniProt

P23560

Additional BDNF Products

Product Documents for BDNF Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BDNF Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BDNF Antibody - BSA Free

Customer Reviews for BDNF Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BDNF Antibody - BSA Free and earn rewards!

Have you used BDNF Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BDNF Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

    • Q: I have ordered the BDNF Antibody (CAT: NBP1-59304) from you all and was curious if the antibody had been tested as to whether or not it can recognize the pro-BDNF form of the BDNF protein in addition to the mature cleaved BDNF form.
      A: The immunogen lies within the range of aa 145-195. Therefore the antibody will detect full length and the cleaved form range 129-247.          Signal peptide 1 – 18                                                                                                                                                       Propeptide 19 – 128                                                                                                                                                              Chain 129 – 247 Brain-derived neurotrophic factor
      http://www.uniprot.org/uniprot/P23560
      Immunogen
      Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence
      145 EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG 195
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies