Biliverdin Reductase B/BLVRB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83435

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Biliverdin Reductase B/BLVRB Antibody - BSA Free

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human colon, liver, small intestine and spleen using Anti-BLVRB antibody NBP1-83435 (A) shows similar protein distribution across tissues to independent antibody NBP1-83434 (B).
Immunocytochemistry/ Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunocytochemistry/ Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunocytochemistry/Immunofluorescence: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435]

Immunohistochemistry-Paraffin: Biliverdin Reductase B/BLVRB Antibody [NBP1-83435] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Biliverdin Reductase B/BLVRB Antibody - BSA Free Western Blot: Biliverdin Reductase B/BLVRB Antibody - BSA Free [NBP1-83435]

Western Blot: Biliverdin Reductase B/BLVRB Antibody - BSA Free [NBP1-83435]

Analysis in human cell lines A-549 and U-251MG using Anti-BLVRB antibody. Corresponding BLVRB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Applications for Biliverdin Reductase B/BLVRB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Biliverdin Reductase B/BLVRB

The final step in heme metabolism in mammals is catalyzed by the cytosolic biliverdin reductase enzymes A and B (EC1.3.1.24).(supplied by OMIM)

Alternate Names

BLVRB, BVRB, FLR, GHBP

Gene Symbol

BLVRB

Additional Biliverdin Reductase B/BLVRB Products

Product Documents for Biliverdin Reductase B/BLVRB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Biliverdin Reductase B/BLVRB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Biliverdin Reductase B/BLVRB Antibody - BSA Free

Customer Reviews for Biliverdin Reductase B/BLVRB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Biliverdin Reductase B/BLVRB Antibody - BSA Free and earn rewards!

Have you used Biliverdin Reductase B/BLVRB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...