BNIP3L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88558

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (98%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BNIP3L Antibody - BSA Free

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining in human placenta and pancreas tissues using anti-BNIP3L antibody. Corresponding BNIP3L RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558]

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558]

Immunocytochemistry/Immunofluorescence: BNIP3L Antibody [NBP1-88558] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]

Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human placenta shows high expression.
BNIP3L Antibody

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BNIP3L Antibody

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BNIP3L Antibody

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BNIP3L Antibody

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BNIP3L Antibody

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -

Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for BNIP3L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BNIP3L

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, Hrk, Nip3, and Bim, form a growingsubclass of the Bcl-2 family. A novel BH3 domaincontaining protein was recently identified and designated Bnip3L, Bnip3a, and Nix (for Nip3-like protein X) (Matsushima, M. et al.; Yasuda, M. et al.; Chen, G, et al.).Bnip3L/Bnip3a/Nix is a homolog of the E1B 19K/Bcl-2 binding and pro-apoptotic protein Bnip3. Over expression of Bnip3L induces apoptosis (Yasuda, M. et al.; Chen, G, et al.). Bnip3L interacts withand overcomes suppresses by Bcl-2 and Bcl-xL. Bnip3Lis localized in mitochondria. The messenger RNA of Bnip3L is ubiquitously expressed in human tissues (Matsushima, M. et al.; Yasuda, M. et al.). Bnip3L and Bnip3 form a new subfamily of the pro-apoptotic mitochondrial proteins.

Long Name

BCL2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3-Like

Alternate Names

BNIP3a, Nip3L, Nix

Gene Symbol

BNIP3L

Additional BNIP3L Products

Product Documents for BNIP3L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BNIP3L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for BNIP3L Antibody - BSA Free

Customer Reviews for BNIP3L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BNIP3L Antibody - BSA Free and earn rewards!

Have you used BNIP3L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...