BNIP3L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88558
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BNIP3L Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558]
Immunocytochemistry/Immunofluorescence: BNIP3L Antibody [NBP1-88558] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria. Antibody staining is shown in green.Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558]
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP1-88558] - Staining of human placenta shows high expression.Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] -
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody [NBP1-88558] - The role of PA in BNIP3 silenced UCB-hMSC survival in the mouse skin wound healing model. (A) Mouse skin wound surgery with UCB-hMSC transplantation was performed as described in Section 2. Representative gross wound images were acquired at post injection days 0, 4, 8, 12. Skin wound sizes at day 8 were compared with wound size at day 0. n = 5. (B) Tissue slide samples were stained with hematoxylin & eosin. Low & high magnified histological gross images are shown in the left & right panels, respectively. Scale bars, 260 µm (magnification, ×40) & 100 µm (magnification, ×100). n = 5. (C) Representative images of blood vessels in skin wounds on day 12 (top panel). Vessel density was analyzed by using ImageJ program (bottom panel). n = 5. (D-F) Histological tissue samples were immuno-stained with CD31, alpha -SMA, & HNA-specific antibodies & PI for counterstaining. alpha -SMA & HNA-positive cells were visualized by confocal microscopy. The number of CD31 & alpha -SMA-positive cells in high power field (HPF), & the percentage of HNA-positive cells in total cells were analyzed by using Metamorph software. Scale bars, 100 µm (magnification, ×100). n = 5. Data are presented as a mean ± S.E.M. $p < 0.05 versus vehicle group, *p < 0.05 versus UCB-hMSC group given NT siRNA, #p < 0.05 versus UCB-hMSC group given NT siRNA with hypoxia pretreatment, @p < 0.05 versus UCB-hMSC group given BNIP3 siRNA with hypoxia pretreatment. Image collected & cropped by CiteAb from the following publication (https://linkinghub.elsevier.com/retrieve/pii/S2213231717303804), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for BNIP3L Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BNIP3L
Long Name
BCL2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3-Like
Alternate Names
BNIP3a, Nip3L, Nix
Gene Symbol
BNIP3L
Additional BNIP3L Products
Product Documents for BNIP3L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BNIP3L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for BNIP3L Antibody - BSA Free
Customer Reviews for BNIP3L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BNIP3L Antibody - BSA Free and earn rewards!
Have you used BNIP3L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...