BRP44L Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91706
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Applications
Validated:
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BRP44L Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: BRP44L Antibody [NBP1-91706]
Immunocytochemistry/Immunofluorescence: BRP44L Antibody [NBP1-91706] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human kidney shows moderate to strong positivity in mitochondria in cells in tubules.Western Blot: BRP44L Antibody [NBP1-91706]
Western Blot: BRP44L Antibody [NBP1-91706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissueImmunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human duodenum shows strong positivity in mitochondria in glandular cells.Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human pancreas shows weak positivity in exocrine glandular cells as expected.Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human salivary gland shows strong positivity in mitochondria in ductal cells.Western Blot: BRP44L Antibody [NBP1-91706] -
Western Blot: BRP44L Antibody [NBP1-91706] - Characterization of MPC1−/− in the RM-1 murine prostate cancer cells(A) Shows representative sequencings of the MPC1 PCR products in WT & MPC1−/− cells. The upper panel shows a representative MPC1 PCR product sequencing chart of WT cells at the left part, & the right part on the upper panel shows the full cDNA sequence & the speculated amino acids (110 amino acids). The left part on the lower panel shows a representative MPC1 PCR product of the MPC1−/− cells, which reveals double sets of peak. The right part of the lower panel shows the mutated DNA sequences at both alleles, on which one allele on the upper part has a two-base “at” deletion (green arrow), while another allele on the lower part harbors one base “a” insertion (red arrow). Both mutated sequences create an early terminator “tga”, which results in only 1/3 of the translation (41 amino acids in the upper allele & 42 amino cods in another allele). (B) The IF & IHC results. Co-localization of MPC1 or MPC2 & the mitochondrial protein MT-CO1 are shown in the WT RM-1 cells, while there is no MPC1 protein expression revealed by either IF or ICC in the MPC1−/− cells. There was only weak MPC2 protein expression in the MPC1−/− cells revealed by ICC. Scale bars, 200 μm. Western blotting results of subcellular proteins from WT & MPC1−/− cells & corresponding densitometry histograms of ALT1 & PC are shown in (C). Cyto means cytoplasmic protein. Mito stands for mitochondrial protein. Protein alpha -Tublin was used as a loading control. ***P<0.001. All experiments were performed at least three times with consistent & repeatable results. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28624784), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BRP44L Antibody [NBP1-91706] -
Western Blot: BRP44L Antibody [NBP1-91706] - The results of western blotting & RT-PCR assayA. shows Western blotting results, where the PDHA1 protein expression in the parental LNCaP cells is strongly positive, but its expression in the PDHA1 KO cells is almost negative with two different PDHA1 antibodies. Comparatively, the protein expression of the MPC1 & MPC2 is comparatively decreased & the protein expression of the GLUT1, HK2, LDHA, HIF1 alpha, GLS1 & GLUD1 is increased in the LNCaP PDHA1 KO cells. GAPDH was added as a loading control. B. shows the RT-PCR results of the mRNA expression of GLUD1 & GLS1, where the expression of the GLUD1 & GLS1 is significantly increased in the PDHA1 KO cells, with P values of 0.000 & 0.001, respectively, compared to the parental LNCaP cells. **P < 0.01, ***P<0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27462778), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BRP44L Antibody - BSA Free [NBP1-91706]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Applications for BRP44L Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BRP44L
Long Name
Mitochondrial pyruvate carrier 1
Alternate Names
CGI-129, HSPC040, MPC1, PNAS-115
Gene Symbol
MPC1
Additional BRP44L Products
Product Documents for BRP44L Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BRP44L Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for BRP44L Antibody - BSA Free
Customer Reviews for BRP44L Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BRP44L Antibody - BSA Free and earn rewards!
Have you used BRP44L Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...