BYSL Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89501
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human, Mouse
Predicted:
Rat (91%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Block/Neutralize
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BYSL Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: BYSL Antibody [NBP1-89501]
Immunocytochemistry/Immunofluorescence: BYSL Antibody [NBP1-89501] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human gastrointestinal, lymphoid tissues, placenta and testis using Anti-BYSL antibody NBP1-89501 (A) shows similar protein distribution across tissues to independent antibody NBP1-89500 (B).Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human placenta shows strong positivity in nucleoli in trophoblastic cells.Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human lymph node shows strong positivity in nucleoli in lymphoid cells.Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.Western Blot: BYSL Antibody - BSA Free [NBP1-89501]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in TCGA database. (C) Immunocytochemical staining of BYSL in osteosarcoma tissues (n = 51, scale bar = 50 um). (D) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in an in-house cohort. (E) MG63 and Saos-2 cells were transfected with the control plasmid (oe-NC) or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic or normoxic conditions. After nuclear and cytosolic separation, protein levels of Nrf2, BYSL, Histone H3, and beta -Actin were measured by western blot. (F) MG63 and Saos-2 cells were transfected with control plasmid (oe-NC), BYSL overexpression plasmid (oe-BYSL), si-control (si-NC), or si-Nrf2, and then cultured under hypoxic condtions. The protein levels of Nrf2, E-cadherin, N-cadheirn, Vimentin, and beta -Actin were measured by western blot. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC) or miR-378a-3p-inhibitor, and then cultured under normoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL is a direct target of miR-378a-3p. (A) MG63 and Saos-2 cells were cultured under hypoxic or normoxic conditions. The RNA levels of miR-378a-3p and BYSL were measured by RT-qPCR. (B) The 3′-untranslated region (UTR) of BYSL harbor potential miR-378a-3p binding sites. (C) The luciferase activity displayed by the luciferase reporter constructs which contained wild-type (WT) or mutant (MUT) 3′-UTR of BYSL were co-transfected with miR-378a-3p mimic into MG63 and Saos-2 cells. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-378a-3p-NC) or miR-378a-3p-mimic, and then cultured under hypoxic or normoxic conditions. The protein levels of BYSL, E-cadherin, N-cadherin, and Vimentin were measured by western blot. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC) or miR-378a-3p-inhibitor, and then cultured under normoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured under hypoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured under hypoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -
BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in TCGA database. (C) Immunocytochemical staining of BYSL in osteosarcoma tissues (n = 51, scale bar = 50 um). (D) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in an in-house cohort. (E) MG63 and Saos-2 cells were transfected with the control plasmid (oe-NC) or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic or normoxic conditions. After nuclear and cytosolic separation, protein levels of Nrf2, BYSL, Histone H3, and beta -Actin were measured by western blot. (F) MG63 and Saos-2 cells were transfected with control plasmid (oe-NC), BYSL overexpression plasmid (oe-BYSL), si-control (si-NC), or si-Nrf2, and then cultured under hypoxic condtions. The protein levels of Nrf2, E-cadherin, N-cadheirn, Vimentin, and beta -Actin were measured by western blot. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for BYSL Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BYSL
Alternate Names
by the ribosomal protein s6 gene, drosophila, homolog-like, BYSTIN, bystin-like
Gene Symbol
BYSL
Additional BYSL Products
Product Documents for BYSL Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BYSL Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for BYSL Antibody - BSA Free
Customer Reviews for BYSL Antibody - BSA Free
There are currently no reviews for this product. Be the first to review BYSL Antibody - BSA Free and earn rewards!
Have you used BYSL Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...