BYSL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89501

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Block/Neutralize

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BYSL Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BYSL Antibody [NBP1-89501]

Immunocytochemistry/ Immunofluorescence: BYSL Antibody [NBP1-89501]

Immunocytochemistry/Immunofluorescence: BYSL Antibody [NBP1-89501] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human gastrointestinal, lymphoid tissues, placenta and testis using Anti-BYSL antibody NBP1-89501 (A) shows similar protein distribution across tissues to independent antibody NBP1-89500 (B).
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human placenta shows strong positivity in nucleoli in trophoblastic cells.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human lymph node shows strong positivity in nucleoli in lymphoid cells.
Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501]

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.
Western Blot: BYSL Antibody [NBP1-89501]

Western Blot: BYSL Antibody [NBP1-89501]

Western Blot: BYSL Antibody [NBP1-89501] - Analysis using Anti-BYSL antibody NBP1-89501 (A) shows similar pattern to independent antibody NBP1-89500 (B).
BYSL Antibody - BSA Free Western Blot: BYSL Antibody - BSA Free [NBP1-89501]

Western Blot: BYSL Antibody - BSA Free [NBP1-89501]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in TCGA database. (C) Immunocytochemical staining of BYSL in osteosarcoma tissues (n = 51, scale bar = 50 um). (D) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in an in-house cohort. (E) MG63 and Saos-2 cells were transfected with the control plasmid (oe-NC) or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic or normoxic conditions. After nuclear and cytosolic separation, protein levels of Nrf2, BYSL, Histone H3, and beta -Actin were measured by western blot. (F) MG63 and Saos-2 cells were transfected with control plasmid (oe-NC), BYSL overexpression plasmid (oe-BYSL), si-control (si-NC), or si-Nrf2, and then cultured under hypoxic condtions. The protein levels of Nrf2, E-cadherin, N-cadheirn, Vimentin, and beta -Actin were measured by western blot. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC) or miR-378a-3p-inhibitor, and then cultured under normoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL is a direct target of miR-378a-3p. (A) MG63 and Saos-2 cells were cultured under hypoxic or normoxic conditions. The RNA levels of miR-378a-3p and BYSL were measured by RT-qPCR. (B) The 3′-untranslated region (UTR) of BYSL harbor potential miR-378a-3p binding sites. (C) The luciferase activity displayed by the luciferase reporter constructs which contained wild-type (WT) or mutant (MUT) 3′-UTR of BYSL were co-transfected with miR-378a-3p mimic into MG63 and Saos-2 cells. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-378a-3p-NC) or miR-378a-3p-mimic, and then cultured under hypoxic or normoxic conditions. The protein levels of BYSL, E-cadherin, N-cadherin, and Vimentin were measured by western blot. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL knockdown partially abolishes miR-378a-3p-mediated osteosarcoma cell epithelial-to-mesenchymal transition (EMT), invasion, migration, and apoptosis under normoxia. (A) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC) or miR-378a-3p-inhibitor, and then cultured under normoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-inhibitor (miR-NC), miR-378a-3p-inhibitor, si-control (si-NC), or si-BYSL, and then cultured under normoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured under hypoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL overexpression rescues the effect of miR-378a-3p overexpression on osteosarcoma cells under hypoxia. (A) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC) or miR-378a-3p-mimic, and then cultured under hypoxic conditions. The RNA level of miR-378a-3p was measured by RT-qPCR. (B,C) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. The protein levels of Bax, Bcl-2, E-cadherin, N-cadherin, vimentin, BYSL and Nrf2 were measured by western blot. (D) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell apoptosis was measured by flow cytometry. (E) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell invasion was measured by matrigel invasion assay. Scale bar = 100 um. (F) MG63 and Saos-2 cells were transfected with control-mimic (miR-NC), miR-378a-3p-mimic, control plasmid (oe-NC), or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic conditions. Cell migration was measured by scratch wound healing assay. Scale bar = 500 um. The data are presented as the mean +/- SD. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BYSL Antibody - BSA Free

Western Blot: BYSL Antibody - BSA Free [NBP1-89501] -

BYSL is related to the poor prognosis of patients with osteosarcoma. (A) Cluster heatmap of differentially expressed genes in GSE126209. (B) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in TCGA database. (C) Immunocytochemical staining of BYSL in osteosarcoma tissues (n = 51, scale bar = 50 um). (D) Overall survival was compared between osteosarcoma patients with high and low BYSL expression in an in-house cohort. (E) MG63 and Saos-2 cells were transfected with the control plasmid (oe-NC) or BYSL overexpression plasmid (oe-BYSL), and then cultured under hypoxic or normoxic conditions. After nuclear and cytosolic separation, protein levels of Nrf2, BYSL, Histone H3, and beta -Actin were measured by western blot. (F) MG63 and Saos-2 cells were transfected with control plasmid (oe-NC), BYSL overexpression plasmid (oe-BYSL), si-control (si-NC), or si-Nrf2, and then cultured under hypoxic condtions. The protein levels of Nrf2, E-cadherin, N-cadheirn, Vimentin, and beta -Actin were measured by western blot. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35154253), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for BYSL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BYSL

Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi.

Alternate Names

by the ribosomal protein s6 gene, drosophila, homolog-like, BYSTIN, bystin-like

Gene Symbol

BYSL

Additional BYSL Products

Product Documents for BYSL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BYSL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BYSL Antibody - BSA Free

Customer Reviews for BYSL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BYSL Antibody - BSA Free and earn rewards!

Have you used BYSL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...