Carboxylesterase 1 hydrolyzes ester- and amide bonds of substrates ranging from small molecule esters such as phenylester to long-chain fatty acid esters and thioesters. It plays a major role in the pharmacokinetic behavior of many therapeutic agents containing an ester. Through de-esterification, it participates in the detoxification of drugs such as cocaine and heroin in serum and liver.
Carboxylesterase 1/CES1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85691
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Carboxylesterase 1/CES1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human liver and cerebral cortex tissues using NBP1-85691 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human lung shows strong cytoplasmic positivity in macrophages.Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Simple Western lane view shows a specific band for CES1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691]
Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Electropherogram image(s) of corresponding Simple Western lane view. CES1 antibody was used at 1:20 dilution on RT-4 lysate(s).Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody - BSA Free [NBP1-85691]
Staining of human liver shows strong cytoplasmic positivity in hepatocytes.Western Blot: Carboxylesterase 1/CES1 Antibody - BSA Free [NBP1-85691]
Analysis in human cell line HepG2.Applications for Carboxylesterase 1/CES1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Simple Western
1:20
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 56 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 56 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Carboxylesterase 1/CES1
Alternate Names
ACAT, CES1, Egasyn, HMSE1, REH, SES1, TGH
Gene Symbol
CES1
Additional Carboxylesterase 1/CES1 Products
Product Documents for Carboxylesterase 1/CES1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Carboxylesterase 1/CES1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Carboxylesterase 1/CES1 Antibody - BSA Free
Customer Reviews for Carboxylesterase 1/CES1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Carboxylesterase 1/CES1 Antibody - BSA Free and earn rewards!
Have you used Carboxylesterase 1/CES1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...