Catalase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38646

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Catalase Antibody - BSA Free

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining in human liver and pancreas tissues using anti-CAT antibody. Corresponding CAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human bone marrow, liver, lymph node and pancreas using Anti-CAT antibody NBP2-38646 (A) shows similar protein distribution across tissues to independent antibody NBP2-38772 (B).
Western Blot: Catalase Antibody [NBP2-38646]

Western Blot: Catalase Antibody [NBP2-38646]

Western Blot: Catalase Antibody [NBP2-38646] - Analysis in human cell line RT-4 and human cell line CACO-2.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human liver using Anti-CAT antibody NBP2-38646.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human pancreas using Anti-CAT antibody NBP2-38646.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646]

Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-38646] - Staining of human liver shows high expression.

Applications for Catalase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Catalase

Human catalase is an heme-containing peroxisomal enzyme that breaks down hydrogen peroxide to water and oxygen; it is implicated in ethanol metabolism, inflammation, apoptosis, aging and cancer. The 1.5A resolution human enzyme structure, both with and without bound NADPH, establishes the conserved features of mammalian catalase fold and assembly, implicates Tyr370 as the tyrosine radical, suggests the structural basis for redox-sensitive binding of cognate mRNA via the catalase NADPH binding site, and identifies an unexpectedly substantial number of water-mediated domain contacts (1). Because catalase has a low affinity for H2O2, it has been suggested that glutathione peroxidase clears most H2O2 within the erthrocyte and that catalase is of little import. It has been hypothesized that erythrocyte catalase might function to protect heterologous somatic cells against challenge by high levels of exogenous H2O2 (e.g., in areas of inflamation) (2).

Alternate Names

Cas1, CAT, Cs-1

Gene Symbol

CAT

UniProt

Additional Catalase Products

Product Documents for Catalase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Catalase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Catalase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Catalase Antibody - BSA Free and earn rewards!

Have you used Catalase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...