Recombinant Human CD11b GST (N-Term) Protein
Novus Biologicals | Catalog # H00003684-Q01
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro)
Amino Acid Sequence: QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Scientific Data Images for Recombinant Human CD11b GST (N-Term) Protein
SDS-PAGE: Recombinant Human CD11b GST (N-Term) Protein [H00003684-Q01]
SDS-Page: Recombinant Human CD11b Protein [H00003684-Q01] - 12.5% SDS-PAGE using Recombinant Human CD11b Protein [H00003684-Q01] stained with Coomassie Blue.Formulation, Preparation, and Storage
H00003684-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: CD11b/Integrin alpha M
References
1. Rosetti, F., & Mayadas, T. N. (2016). The many faces of Mac-1 in autoimmune disease. Immunol Rev, 269(1), 175-193. doi:10.1111/imr.12373
2. Kim, D., Kim, T. H., Wu, G., Park, B. K., Ha, J. H., Kim, Y. S.,... Kwon, H. J. (2016). Extracellular Release of CD11b by TLR9 Stimulation in Macrophages. PLoS One, 11(3), e0150677. doi:10.1371/journal.pone.0150677
3. Christensen, J. E., Andreasen, S. O., Christensen, J. P., & Thomsen, A. R. (2001). CD11b expression as a marker to distinguish between recently activated effector CD8(+) T cells and memory cells. Int Immunol, 13(4), 593-600. doi:10.1093/intimm/13.4.593
4. Nath, S. K., Han, S., Kim-Howard, X., Kelly, J. A., Viswanathan, P., Gilkeson, G. S.,... Harley, J. B. (2008). A nonsynonymous functional variant in integrin-alpha(M) (encoded by ITGAM) is associated with systemic lupus erythematosus. Nat Genet, 40(2), 152-154. doi:10.1038/ng.71
Alternate Names
Gene Symbol
Additional CD11b/Integrin alpha M Products
Product Documents for Recombinant Human CD11b GST (N-Term) Protein
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Recombinant Human CD11b GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Recombinant Human CD11b GST (N-Term) Protein
There are currently no reviews for this product. Be the first to review Recombinant Human CD11b GST (N-Term) Protein and earn rewards!
Have you used Recombinant Human CD11b GST (N-Term) Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Recombinant Human CD11b GST (N-Term) Protein
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.
-
Q: Do you know if this CD11b antibody can be used in CD11b positive cell depletion?
A: This particular CD11b antibody is not reccomended for depletion studies due to the preservative used; however, our CD11b antibody NBP1-06650 is offered in a preservative free format and has been validated for blocking.
-
Q: I am looking for a Mac-1 (microglia cell marker) antibody to do immunostaining with my mouse brain and I checked, you have a lot of antibodies for this biomarker. I don't know which one is the best to be used for immunohistology on mouse brain tissue. Could you please help with this?
A:
I would recommend NB110-89474. This antibody has been published in 11 scientific articles, including several times in IHC in mouse. As long as CD11b is expressed in your sample, it should work just fine and is backed by our 100% Novus Guarantee.
-
Q: I'm not sure if this will work for me, can I get a free sample of your CD11b antibody to test?
A: We don't offer free samples but we do offer this CD11b antibody in a trial size of 0.025 ml at a reduced cost, all antibodies are backed by our 100% guarantee to work in all validated species and applications on the product's web page.
-
Q: Is CD11b antibody also staining neutrophils in the brain
A: CD11b is typically used as a marker for granulocytes and macrophages. You may need a combination of markers to specifically identify neutrophils
-
Q: Looking for a bone marrow macrophage marker can you recommend a CD11b antibody for ICC?
A: I would recommend NB110-89474 which is our most popular CD11b antibody and has been validated in ICC and cited in 18 publications.
-
Q: The protocol says to do enzymatic antigen retrieval before incubating with the CD11b antibody, which enzyme is used?
A: The protocol is referencting the PIER method using Proteinase K as the enzyme.
-
Q: We need a CD11b antibody for IHC-P on mouse tissue conjugated to FITC, do you have one that will work?
A: We have 3 CD11b antibodies for IHC-P and just one CD11 b antibody we offer conjugated to FITC, NB110-89474F.
-
Q: What types of cells can this CD11b antibody be used as a marker for?
A: A study used this CD11b antibody to stain granulocytes in mouse uterine tissue in IHC. CD11b is also expressed on other leukocytes such as monocytes, macrophages, and natural killer cells.