CD27/TNFRSF7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38434
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CD27/TNFRSF7 Antibody - BSA Free
Western Blot: CD27/TNFRSF7 Antibody [NBP2-38434]
Western Blot: CD27/TNFRSF7 Antibody [NBP2-38434] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line Daudi
Immunohistochemistry-Paraffin: CD27/TNFRSF7 Antibody [NBP2-38434]
Staining of human tonsil shows high expression.Immunohistochemistry-Paraffin: CD27/TNFRSF7 Antibody [NBP2-38434]
Staining of human cerebral cortex shows low expression as expected.Applications for CD27/TNFRSF7 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CD27/TNFRSF7
Membrane-bound CD27 is expressed as a disulfide-linked homodimer (3). CD27 binds to the ligand CD70, a transmembrane glycoprotein that is transiently expressed on activated immune cells such as antigen presenting cells (APCs), dendritic cells (DCs), NK cells, B cells, and T cells (1,2,6,7). The receptor-ligand binding interaction leads to NFkappaB and c-Jun pathway activation which promotes immune stimulation and activation and survival of CD4+ T cells, CD8+ T cells, memory T cells, and NK cells (2,6,7). Both CD27 and CD70 are often abnormally expressed or dysregulated on malignant and cancer cells leading to immune evasion and tumor progression (7). CD27 has become a target of interest of immunotherapies for viral infections, autoimmune disease, and cancer (2). Varlilumab, an agonistic CD27 monoclonal antibody (mAB), has entered clinical trials for the treatment of hematological and solid tumor cancers (1,6). Additional clinical trials are in process that combine varlilumab with other immune checkpoint inhibitors like the programmed cell death protein-1 (PD-1) blocking mAb nivolumab (1,2). Initial results are promising, suggesting that targeting CD27, especially in combination with other therapeutics, may be a promising and effective immunotherapy for a variety of pathologies (1,2,6).
References
1. Starzer AM, Berghoff AS. New emerging targets in cancer immunotherapy: CD27 (TNFRSF7). ESMO Open. 2020;4(Suppl 3):e000629. https://doi.org/10.1136/esmoopen-2019-000629
2. Grant EJ, Nussing S, Sant S, Clemens EB, Kedzierska K. The role of CD27 in anti-viral T-cell immunity. Curr Opin Virol. 2017;22:77-88. https://doi.org/10.1016/j.coviro.2016.12.001
3. Buchan SL, Rogel A, Al-Shamkhani A. The immunobiology of CD27 and OX40 and their potential as targets for cancer immunotherapy. Blood. 2018;131(1):39-48. https://10.1182/blood-2017-07-741025
4. Uniprot (P26842)
5. Uniprot (P41272)
6. van de Ven K, Borst J. Targeting the T-cell co-stimulatory CD27/CD70 pathway in cancer immunotherapy: rationale and potential. Immunotherapy. 2015;7(6):655-667. https://doi.org/10.2217/imt.15.32
7. Flieswasser T, Van den Eynde A, Van Audenaerde J, et al. The CD70-CD27 axis in oncology: the new kids on the block. J Exp Clin Cancer Res. 2022;41(1):12. https://doi.org/10.1186/s13046-021-02215-y
Additional CD27/TNFRSF7 Products
Product Documents for CD27/TNFRSF7 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CD27/TNFRSF7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CD27/TNFRSF7 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CD27/TNFRSF7 Antibody - BSA Free and earn rewards!
Have you used CD27/TNFRSF7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...