CD38 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86010

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This CD38 antibody was developed against Recombinant Protein corresponding to amino acids: AACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit CD38 Antibody - BSA Free (NBP1-86010) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CD38 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CD38 Antibody [NBP1-86010]

Immunocytochemistry/ Immunofluorescence: CD38 Antibody [NBP1-86010]

Immunocytochemistry/Immunofluorescence: CD38 Antibody [NBP1-86010] - Staining of human cell line A549 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010] - Staining in human tonsil and kidney tissues using NBP1-86010 antibody. Corresponding CD38 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010] - Staining of human prostate shows strong membranous/cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010] - Staining of human rectum shows strong membranous/cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010]

Immunohistochemistry-Paraffin: CD38 Antibody [NBP1-86010] - Staining of human tonsil shows strong membranous/cytoplasmic positivity in non-germinal center cells.
CD38 Antibody - BSA Free Western Blot: CD38 Antibody - BSA Free [NBP1-86010]

Western Blot: CD38 Antibody - BSA Free [NBP1-86010]

Analysis in human cell line Daudi.

Applications for CD38 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD38

CD38 (cluster of differentiation 38), previously known as T10, is a 46 kDa type II transmembrane glycoprotein (1). CD38 is expressed in both lymphoid and non-lymphoid tissue including in thymocytes, T and B lymphocytes, myeloid cells, natural killer cells, plasma cells, erythrocytes, and additionally in cells of the brain, pancreas, muscle, and bone (1,2). Structurally, CD38 is an "L"-shape which is formed by two separate domains connected by a three peptide-chain hinge region (2). The N-terminal domain is composed of five alpha-helices and two beta strands, while the C-terminal domain contains a four-stranded parallel beta-sheet and two long and two short alpha-helices (2). The CD38 molecule is located on chromosome 4 and is 300 amino acids (aa) in length with a theoretical molecular weight of 34 kDa that functions as both a receptor and an enzyme (1-6). As a receptor, CD38 interacts with its ligand CD31, which is largely expressed in endothelial cells (2-6). As an ectoenzyme, CD38 has a role in calcium signaling and is responsible for the conversion of nicotinamide adenine dinucleotide (NAD) into adenosine diphosphate-ribose (ADPR) or cyclic ADPR and the conversion of phosphorylated NAD (NADP) into nicotinic acid adenine dinucleotide phosphate (NAADP) (2-6).

As described above, CD38 is highly expressed in plasma cells and, as a result, is a target for treating multiple myeloma (MM), the cancer of white blood cells (4,6). The anti-CD38 monoclonal antibody daratumumab is one specific treatment for MM (4,6). Daratumumab has been shown to target MM cells through antibody-dependent cellular cytotoxicity and antibody dependent cellular phagocytosis (4). Additionally, CD38 has a potential role in neurodegenerative disorders and neuroinflammation as elucidated CD38's high expression in neurons, astrocytes, and microglia along with its enzymatic role in NAD degradation (3). Reduced NAD levels is a consequence of aging and occurs during neurodegeneration (3). Furthermore, murine studies have found that CD38 deletion inhibits neuroinflammation and neurodegeneration and therefore might be a potential therapeutic target (3). Similarly, CD38 inhibitors, like quercetin and luteolin, are used to treat age-related diseases and metabolic disorders (7).

References

1. Malavasi, F., Funaro, A., Alessio, M., DeMonte, L. B., Ausiello, C. M., Dianzani, U., Lanza, F., Magrini, E., Momo, M., & Roggero, S. (1992). CD38: a multi-lineage cell activation molecule with a split personality. International journal of clinical & laboratory research. https://doi.org/10.1007/BF02591400

2. Malavasi, F., Deaglio, S., Funaro, A., Ferrero, E., Horenstein, A. L., Ortolan, E., Vaisitti, T., & Aydin, S. (2008). Evolution and function of the ADP ribosyl cyclase/CD38 gene family in physiology and pathology. Physiological reviews. https://doi.org/10.1152/physrev.00035.2007

3. Guerreiro, S., Privat, A. L., Bressac, L., & Toulorge, D. (2020). CD38 in Neurodegeneration and Neuroinflammation. Cells. https://doi.org/10.3390/cells9020471

4. van de Donk, N., Richardson, P. G., & Malavasi, F. (2018). CD38 antibodies in multiple myeloma: back to the future. Blood. https://doi.org/10.1182/blood-2017-06-740944

5. Lund, F. E., Cockayne, D. A., Randall, T. D., Solvason, N., Schuber, F., & Howard, M. C. (1998). CD38: a new paradigm in lymphocyte activation and signal transduction. Immunological reviews. https://doi.org/10.1111/j.1600-065x.1998.tb01573.x

6. Glaria, E., & Valledor, A. F. (2020). Roles of CD38 in the Immune Response to Infection. Cells. https://doi.org/10.3390/cells9010228

7. Rajman, L., Chwalek, K., & Sinclair, D. A. (2018). Therapeutic Potential of NAD-Boosting Molecules: The In Vivo Evidence. Cell metabolism. https://doi.org/10.1016/j.cmet.2018.02.011

Long Name

Cluster of Differentiation 38

Alternate Names

ADP-ribosyl Cyclase, CD38, Cyclic ADP-ribose Hydrolase

Gene Symbol

CD38

Additional CD38 Products

Product Documents for CD38 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD38 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD38 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD38 Antibody - BSA Free and earn rewards!

Have you used CD38 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD38 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Which is your best antibody anti-human CD38 for IHC-P?

    A: We do have a number of CD38 antibodies validated in IHC-P, please use the filters on the left side of the search page to help find the product that mostly suits to your experimental design.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies