CD40/TNFRSF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33956

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD40/TNFRSF5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Analysis in human tonsil and cerebral cortex tissues. Corresponding CD40/TNFRSF5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD40/TNFRSF5 antibody NBP2-33956 (A) shows similar protein distribution across tissues to independent antibody NBP2-33957 (B).
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human tonsil shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human lymph node shows moderate to strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956]

Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody [NBP2-33956] - Staining of human spleen shows moderate membranous positivity in cells in white pulp.

Applications for CD40/TNFRSF5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD40/TNFRSF5

CD40 and its ligand CD154 are members of the tumor necrosis factor receptor (TNFR) and TNF families, respectively, that play key roles in signaling pathways mediating cell growth, survival and differentiation in B-lymphocytes (reviewed in Quezada et al 2004). The CD40 receptor is a 45-50 kDa glycoprotein and is expressed on the surface of B-lymphocytes, some activated T-cells, monocytes, follicular dendritic cells, basal epithelial cells, and in some epithelial and non-epithelial carcinomas. The functions of CD40 have been most extensively studied in B-cells. Ligation of B CD40 by CD154, expressed on activated T cells, stimulates B cell proliferation, differentiation, isotype switching, upregulation of surface molecules contributing to antigen presentation, development of the germinal center, and the humoral memory response. Several distinct structural motifs in the CD40 cytoplasmic domain regaulate various CD40 signaling pathways. A major CD40 signaling pathway activated from CD154 ligand binding is the canonical pathway to the transcription factor family NF-kB, a family of genes mediating immune and inflammatory responses. Although CD40 has been extensively studied as a plasma membrane-associated growth factor membrane receptor. it has also been identified in the cytoplasm and nucleus of normal and neoplastic B-lymphoid cells (Lin-Lee et al. 2006). Other growth factor receptors, including EGF, FGF, and TGF-B have also been identified in the nuclus. It is thought that plasma membrane receptor signaling may be followed by nuclear migration of signaling pathway components. The presence of CD40 in the nucleus of activated normal B lymphocytes and neoplastic B-lymphoid cells suggests that CD40 may play a more complex role in regulating essential growth and survival pathways in B-lymphocytes than previously thought.

Alternate Names

CD40, TNFRSF5

Gene Symbol

CD40

UniProt

Additional CD40/TNFRSF5 Products

Product Documents for CD40/TNFRSF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD40/TNFRSF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD40/TNFRSF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD40/TNFRSF5 Antibody - BSA Free and earn rewards!

Have you used CD40/TNFRSF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD40/TNFRSF5 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: I wanna know does CD40 antibody for IHC-P comes with positive control slide?

    A: Our CD40 antibodies do not come with positive control slides however you can use any type of primary carcinoma cell as a positive control. I recommend breast carcinoma as this is what we have tested our CD40 antibodies on.

  • Q: We are studying CD40L in our system. It has been known that both CD40 and CD11b are receptors for CD40L. We need CD40 antibody to neutralize CD40 binding to CD40L, then we may prove what is function for CD11b binding to CD40L. Do you have any CD40 Ab which has block function only between CD40 and CD40L, but not between CD11b and CD40L?

    A: Unfortunately, none of our CD40 antibodies have been specifically tested for this application.

  • Q: I wanna know does CD40 antibody for IHC-P comes with positive control slide?

    A: Our CD40 antibodies do not come with positive control slides however you can use any type of primary carcinoma cell as a positive control. I recommend breast carcinoma as this is what we have tested our CD40 antibodies on.

  • Q: We are studying CD40L in our system. It has been known that both CD40 and CD11b are receptors for CD40L. We need CD40 antibody to neutralize CD40 binding to CD40L, then we may prove what is function for CD11b binding to CD40L. Do you have any CD40 Ab which has block function only between CD40 and CD40L, but not between CD11b and CD40L?

    A: Unfortunately, none of our CD40 antibodies have been specifically tested for this application.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies