Cdk9 Antibody (1C4E3)

Novus Biologicals | Catalog # NBP3-15345

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation Sequencing

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1C4E3 expressed in HEK293
View all Cdk9 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750). RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cdk9 Antibody (1C4E3)

Western Blot: Cdk9 Antibody (1C4E3) [NBP3-15345]

Western Blot: Cdk9 Antibody (1C4E3) [NBP3-15345]

Western Blot: Cdk9 Antibody (1C4E3) [NBP3-15345] - Western blot analysis of extracts of various cell lines, using Cdk9 Rabbit mAb (NBP3-15345) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunofluorescence analysis of NIH-3T3 cells using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded mouse brain using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Chromatin Immunoprecipitation Sequencing: Cdk9 Antibody (1C4E3) [NBP3-15345] - Chromatin immunoprecipitations were performed with cross-linked chromatin from DLD-1 cells and Cdk9 Rabbit mAb (NBP3-15345). The ChIP sequencing results indicate the enrichment pattern of Cdk9 in selected genomic region and representative gene loci (e.g. RAC1, GAPDH and ACTB), as shown in figure.
Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunofluorescence analysis of HeLa cells using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded rat ovary using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded human esophageal using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunoprecipitation: Cdk9 Antibody (1C4E3) [NBP3-15345]

Immunoprecipitation: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug Cdk9 antibody (NBP3-15345). Western blot was performed from the immunoprecipitate using Cdk9 antibody (NBP3-15345) at a dilition of 1:1000.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Cdk9 Antibody (1C4E3)

Western Blot: Cdk9 Antibody (1C4E3) [Cdk9] -

Western Blot: Cdk9 Antibody (1C4E3) [Cdk9] - Western blot analysis of lysates from wild type(WT) and Cdk9 knockout (KO) 293T cells, using [KO Validated] Cdk9 Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Cdk9 Antibody (1C4E3)

Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunocytochemistry/ Immunofluorescence: Cdk9 Antibody (1C4E3) [Cdk9] - Confocal imaging of U-2 OS cells using [KO Validated] Cdk9 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Cdk9 Antibody (1C4E3)

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] -

Immunohistochemistry: Cdk9 Antibody (1C4E3) [Cdk9] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] Cdk9 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Cdk9 Antibody (1C4E3)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

1:50 - 1:200

Chromatin Immunoprecipitation Sequencing

2-4 ug/IP

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:400

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:500 - 1:3000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cdk9

CDK9 (PITALRE) (also known as cyclin-dependent kinase 9, Serine/threonine-protein kinase PITALRE, C-2K and Cell division cycle 2-like protein kinase 4) is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2, and known as important cell cycle regulators. CDK9 (PITALRE) interacts with a conserved domain in the TRAF-C region of the tumor necrosis factor signal transducer TRAF2. This kinase also was found to be a component of the multiprotein complex TAK/P-TEFb, which is an elongation factor for RNA polymerase II-directed transcription and functions by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. This protein forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. HIV-1 Tat protein was found to interact with this protein and cyclin T, which suggested a possible involvement of this protein in AIDS. Tat stimulates human HIV-1 viral transcription elongation. This suggests that cyclin T1/cdk9(PITALRE) is one of the HIV-1 required host cellular cofactors generated during T cell activation. Cyclin T1/cdk9(PITALRE) is shown to interact with Tat to restore Tat activation in HeLa nuclear extracts depleted of P-TEFb. The cdk9(PITALRE) activity and cyclin T1 are essential for activation of transcription when tethered to the heterologous Rev response element RNA via the regulator of expression of virion Rev. CDK9 (PITALRE) is a ubiquitously expressed nuclear protein.

Long Name

Cyclin-dependent kinase 9

Alternate Names

C-2K, CDC2L4, TAK

Gene Symbol

CDK9

Additional Cdk9 Products

Product Documents for Cdk9 Antibody (1C4E3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cdk9 Antibody (1C4E3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cdk9 Antibody (1C4E3)

There are currently no reviews for this product. Be the first to review Cdk9 Antibody (1C4E3) and earn rewards!

Have you used Cdk9 Antibody (1C4E3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies